KEGG   Vibrio anguillarum 775: VAA_03034
Entry
VAA_03034         CDS       T01536                                 

Definition
(GenBank) Hypothetical protein
Organism
van  Vibrio anguillarum 775
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEH33022
UniProt: F7YHY9
Position
I:1533971..1534567
AA seq 198 aa
MSDSLLSYFEQELRFIRNETSQFAERHPGTARALGMRKDSIDDPQIARLIESVALMNGKL
QQRLDESYPELTESLVNLLFPHYLRPIPSYSMLDFAIFEEANAKHSILKGTEFDVASESG
EPVVFRTSENIALLPIQVASAEVLFAPFELAKPVGAENAKAMLELTIEATDSGIELRDLD
IDQLKLHLKVKSLCIAFV
NT seq 597 nt   +upstreamnt  +downstreamnt
ttgtctgattcattgctttcctattttgaacaggaactgcgctttattcgcaatgaaacc
tctcagttcgcggaacgtcatccggggacggctcgtgcattgggaatgcgtaaagacagt
attgatgatcctcagatcgcgcgtttgattgaaagtgttgccttgatgaacggcaaactt
cagcagcgtttggatgagtcttacccagagctgacagaaagcttggtgaacttgttgttc
ccgcattatctgaggccaataccgtcatacagcatgttggacttcgctatttttgaagaa
gcgaatgcaaagcacagtattcttaaaggcactgagttcgatgtcgcgagcgaatctggc
gagccagtggtgtttcgtacttccgaaaatatagcgctgcttccaattcaagttgcttcg
gctgaagtgctgtttgcgccatttgaactggctaagcctgtgggtgcagagaacgcaaaa
gcgatgctggagctgacgattgaggcaaccgatagcggtatcgagttgcgtgatctagat
attgaccagttgaaactgcatctcaaggtgaagtcactttgcattgcgtttgtatga

DBGET integrated database retrieval system