KEGG   Vibrio anguillarum 775: VAA_03036
Entry
VAA_03036         CDS       T01536                                 

Definition
(GenBank) Hypothetical cytosolic protein
  KO
K11899  type VI secretion system protein ImpD
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_03036
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VAA_03036
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AEH33020
UniProt: F7YHY7
Position
I:1532210..1533565
AA seq 451 aa
MYTNSEFDRILAENPAWQEILVCAKSRSVVQFKASLVRLISEIDTSISEQLSDVIQHPNF
KQLEASWTGLKSLAQLQVSQRRVKIKMLDLSWSMVSADLNYSFDLKQSSLYRKLYSNELD
TAGGSPFGMVMVDHKVSADYADDQEYDDLYTLQLLSELGELCFCPMVLGTDEFFFGDEPR
RQLHDSARIERILTSRDFVSWQLLREKNSSRFLHLVMPEHLIRQPYCQYQAGFVFNERQQ
EKYALWGSSAYLLLGNVMREFDRISWFGFLRSYDETGSYGAIVQDSKELKTKVEIYSEDD
GFWSSQGFMPLTSIYISGHKGFFSNQSVWQAPDEAQRQLGMLQTNLMACRFAHYIKVQIR
DQVGRYDSAETCRRSLERWLEQFISNVNYGEDAVLARYPLRSCYVRIEEVPHDKTRYLCE
IMLQPQYQYEMMDAKVVLTTSVSGSEVGETS
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtatacaaattccgaattcgatcgcattttagctgagaatcctgcctggcaggagata
ttagtgtgcgcgaaaagtcggtcggtggttcaattcaaagcatcgttggttcgtttgatc
tccgagattgatacgtcaataagtgaacagttgtcagacgttattcaacaccctaacttt
aagcagttagaagcctcttggacggggctcaaatcgttagcgcagctgcaagtatcccag
cgtcgagtaaaaatcaaaatgctcgacttgagttggagtatggtttcggcagatctcaat
tactctttcgatctaaagcagtcatccctataccgaaaactgtattcaaatgagctggat
accgccggtggcagcccatttggcatggtgatggtcgatcacaaggtctcggctgattac
gccgatgatcaggagtatgacgatctctacacccttcaactgctctctgagctgggggag
ctctgtttttgcccaatggtgctcggaactgacgagtttttctttggtgatgaaccaaga
aggcagcttcatgacagcgcgagaattgagcgcattcttactagtcgagattttgtttct
tggcagttgctacgagaaaaaaactcatcacgatttttgcacttggtcatgcctgaacat
ttgattcgtcaaccatactgtcaatatcaggctggatttgtttttaacgagcgccagcaa
gagaaatatgccttgtggggcagcagcgcttacctcttgctaggtaatgtgatgcgagag
tttgatcgaatcagttggtttggattcctgcgttcttacgatgagacaggttcgtatggg
gctatcgttcaggactcaaaagaacttaagaccaaggtagagatctacagtgaagatgat
ggcttttggtcgtctcaggggttcatgcctttaaccagtatttacataagtggccataaa
ggtttcttcagcaatcaatccgtttggcaagcgcctgatgaagctcaacgtcagctcggt
atgctccaaaccaacctgatggcttgccgatttgcccattacatcaaggtccaaattcgt
gatcaagttggtcgatatgacagtgcagaaacttgtcgacgcagtctagagcgatggcta
gagcagttcataagcaacgtcaattatggtgaggatgccgtacttgcccgatatccactg
cggtcttgctatgtacgcattgaagaggttcctcatgataaaacccgctacctatgcgag
atcatgcttcagcctcaatatcaatacgaaatgatggatgcgaaagtggtgttaacaact
tcggtatctggcagtgaggttggagagacatcatga

DBGET integrated database retrieval system