KEGG   Vibrio anguillarum 775: VAA_03039Help
Entry
VAA_03039         CDS       T01536                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
van  Vibrio anguillarum 775
Pathway
van03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:van00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VAA_03039
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_03039
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA_03039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEH33017
UniProt: F7YHY4
Position
I:1529573..1530103
Genome map
AA seq 176 aa AA seqDB search
MASIYMRVSGLQVEGAATIGQLETAEGKNDGWFAINSYSWGGARNVAMDIGNGTNADSGM
VGVSEVSVTKEVDGASEDLLSYLFNPGKDGKTVEVAFTKPSNDGQGADVYFQVKLEKARL
VSYNVSGTDGSQPYESLSLSYTSISQKHHYEKEGGELQSGGVVTYDLPTGKMTSGK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtatttacatgcgtgtaagcggtcttcaagttgagggcgcagcgactatcggt
cagctagaaacggctgaaggtaaaaatgacggttggtttgcaatcaactcttactcttgg
ggtggcgctcgtaacgttgctatggacatcggtaacggcaccaatgcggattcaggcatg
gttggcgtaagcgaagttagcgtaactaaagaagtcgatggtgcttctgaagacctactg
tcttatttattcaacccaggtaaagacggtaaaactgttgaggttgcatttactaagcct
tctaacgatggtcaaggtgcagacgtttacttccaagttaagctagaaaaagcacgttta
gtttcttacaacgtgagcgggactgacggatctcaaccgtacgagagcctatctctttct
tacacttctatttctcagaagcatcactatgagaaagaaggtggtgaactacaaagcggt
ggtgttgtgacttacgacctaccgaccgggaaaatgacttctggtaagtaa

DBGET integrated database retrieval system