KEGG   Vibrio anguillarum 775: VAA_03040
Entry
VAA_03040         CDS       T01536                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_03040
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA_03040
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AEH33016
UniProt: F7YHY3
Position
I:1528113..1529546
AA seq 477 aa
MTLKQIVNLTEQEPMPLSKHQIEQLSKPLSDDSICGVYLKLEKSAFRPLRNEFNVAQTAL
RKLSQNPSADERDALQEACLNKWKILSDSLYEQFSKTTRDIELISWFVAAQFLLDTTLES
AANSLEWLADLSEKHWDHLNPVLPVETLKSDDDKGKEREQADAKVKAFFQLVGDSEESSI
LYAPVLQLPLVGEVTFFDFQSAERKGEISQLKSMLTTTVAQERFAIQFKMENAKRCVTQL
DRLSALVSTKCHSLGSQSTNFGFAKSLLTRVENALVHLSGIKLAPKAEAKTVEQEVAESS
VSEGELPSHMDTKHIERIPMASEQAQTVSQHLHAGNLSELGNLNNMNRDLAFHLLREVSD
YFRQSEPHSPISFLLEKAIRWGYLSLPELLREMMSEQNGDALSTIFNAAGLNHLDQVLLP
EVSTPTVGIESPQTPQAKPSVSDPRSVEEHVSQTSPVDTQSKQDQKPQSSATSALSW
NT seq 1434 nt   +upstreamnt  +downstreamnt
ttgacacttaagcaaatagtcaacctaacagagcaggaacctatgcctttgtcaaagcat
caaattgagcaactttctaaacctctgagtgatgattcgatctgtggcgtttatcttaaa
ctggaaaaaagtgcttttcgcccattacgtaatgaatttaatgtcgcgcaaactgcgctg
cgtaagctaagtcaaaaccctagtgctgacgagagagatgcgttacaagaggcatgtcta
aataagtggaagattctctctgacagtttgtacgaacagttttcaaaaacaaccagagat
atcgagctcatctcatggtttgttgctgctcaattccttctcgataccacattagaaagt
gctgcgaatagccttgagtggttagcggatttaagtgagaagcactgggatcacctcaac
cctgtactaccagttgaaacgctcaaatctgatgatgataagggcaaagaaagagagcaa
gcagatgcgaaagttaaagcatttttccaactagtcggcgatagcgaggaaagctcgatt
ctctatgcgccggtgctgcaactgcccttagtcggggaagtgacgttttttgactttcaa
agtgcagagagaaaaggcgaaatcagccaactgaaatctatgcttacgaccacggtggcg
caagagcgtttcgcgattcaattcaagatggaaaacgccaaacgttgtgtcacccaatta
gatcgtttgtcagcgttggtgagcactaagtgtcattctctaggcagtcaaagtaccaac
ttcggatttgcgaagtcactgcttacccgtgttgaaaacgctttggttcatctaagtgga
attaagttagcaccgaaagcggaggccaagacagtagagcaagaggttgccgaaagttca
gtttctgaaggggagctgccaagccatatggatacaaaacatatagagcgaataccgatg
gcatcagagcaggctcagaccgtaagccaacacttacacgcaggaaacctctctgaactg
ggtaatttaaacaatatgaaccgagacttagctttccatttgttgagagaagtctctgat
tattttcgccagagcgaaccgcatagcccaatttcatttttgttagaaaaagcgattcga
tggggatatttatccttacctgagttgctgcgagaaatgatgtcggaacaaaacggtgac
gctcttagtacgatttttaatgccgccggattgaatcatctcgatcaggttttgctgccg
gaggtgagtactccaacggtgggcattgaaagcccccaaacacctcaagcgaagccttcc
gtttcggatccgcgaagtgttgaagagcatgtatctcagacttcccctgtagatacccaa
tctaagcaagatcaaaaaccacaatcatccgctacgtcggctctgagttggtaa

DBGET integrated database retrieval system