KEGG   Vibrio anguillarum 775: VAA_03759Help
Entry
VAA_03759         CDS       T01536                                 

Definition
(GenBank) Low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    VAA_03759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEH32337
UniProt: F7YLN8
Position
I:complement(781273..782622)
Genome map
AA seq 449 aa AA seqDB search
MIIFSADGFDSLRENESSYAPLVIKRLGITMDILANYGTVLILVAAAFGFMMAIGIGAND
VANAMGTSVGSKALTVKQAIIIAMIFEFAGAYLAGGEVTETIRNSVIEPALFAHQPDVLV
YGMMSALLAAGTWLLLASYMGWPVSTTHSIIGAIIGFACISVGPEAVDWTSVKGIVGSWI
VTPVISGLFAYLIFVSAQRLIFDTENPLMNAKRFVPIYMFITTMVIALVTIKKGLKHIGL
HLSTGEAWLCSAALSGLVMVGGYYYIKRKFANREEDHGFSGVESIFSVLMVITACAMAFA
HGSNDVANAIGPLSAVVSTVESLGAVSAKSSIAWWILPLGGFGIVVGLATLGHKVMATVG
TGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGIAALNLGVVR
NIVASWIVTLPAGALLAVIFFYALQAIFG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttgattattttctccgctgatggttttgactcgcttcgagaaaatgagtccagttatgct
ccgcttgttatcaaaagactaggtattacgatggatatccttgcgaactacggcactgtc
ctgattcttgttgcagccgcttttggcttcatgatggcgattggtattggtgcaaatgat
gttgctaatgcaatgggaacttcagtaggctcaaaagcgctaaccgtaaaacaagctatt
atcattgcgatgatttttgaattcgctggtgcatatttagcgggtggtgaagtaaccgaa
accattcgtaacagcgtcatcgaacccgcacttttcgctcaccaacccgacgttcttgtt
tatggcatgatgtctgcacttctcgccgccggaacatggttattgttggcttcatacatg
ggttggcctgtatcaacgactcactctatcatcggcgccattatcggatttgcctgcata
tctgtcggcccagaagcggttgattggacctcagtaaaaggcatcgtaggcagttggatt
gtcaccccagtcatttctggtttgttcgcctacttaatcttcgtcagtgctcaacgattg
attttcgatactgaaaatccactgatgaatgccaaacgctttgttcctatttatatgttc
atcaccactatggtgatcgcactggttaccatcaaaaaaggccttaaacatataggctta
cacctgagcaccggtgaagcatggttatgttctgcggcgttatcaggccttgttatggtc
ggtggttactactacatcaagagaaaatttgccaaccgcgaagaagaccatgggttttcc
ggtgttgagagcatctttagcgtattgatggtgatcactgcgtgtgcaatggcttttgcg
catggttcaaatgatgtagctaacgcgattggtcctctgtctgcggtggtttcaactgtt
gaaagcttgggtgctgttagtgctaaaagctcaattgcttggtggattttgccactgggt
ggttttggtattgtggttggcctagctacccttggtcacaaagtgatggcgacggtcggt
acgggtatcactgaactgacgccaagccgtggctttgccgctcaattggcaacagcgtca
acggtcgtattggcatcaggtactggccttccaatctcaaccacacaaacacttgttggt
gcggtattaggggttggttttgctcgtggaattgcggcattgaatctaggtgtggtgcgt
aatatcgttgcttcatggattgtcaccttgccagcaggcgctttacttgcggtcattttc
ttctatgccctgcaagcaatatttggctaa

DBGET integrated database retrieval system