KEGG   Vagococcus sp. MN-17: FA707_00335Help
Entry
FA707_00335       CDS       T05965                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vao  Vagococcus sp. MN-17
Pathway
vao03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FA707_00335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vao03011]
    FA707_00335
Ribosome [BR:vao03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FA707_00335
  Bacteria
    FA707_00335
  Archaea
    FA707_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QCI85506
UniProt: A0A4D7CSL9
Position
72002..72349
Genome map
AA seq 115 aa AA seqDB search
MTEQITSARATAKTVRTSPRKSRLVIDLIRGKSVAEAISILKYTPNKAAGLIEKVLMSAV
ANAENNFDLDVEKLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVTEK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaaattacttcagcaagagcaactgctaaaacagtacgcacttcacctcgt
aaatcacgtttagtgatcgacttaattagaggtaaaagcgttgcggaagctatttcaatc
ttgaaatacactccaaacaaagcagctggtctaattgaaaaagtattaatgtctgctgta
gctaatgcagaaaacaactttgatttagatgttgaaaaattggtagtatctgaagcattt
gttaacgaaggaccaacgatgaaacgtttccgtccacgtgcgaaaggttcagcttcacca
atcaacaaaagaacaagtcatattacagtagtagtgactgagaaatag

DBGET integrated database retrieval system