KEGG   Variovorax paradoxus S110: Vapar_0192Help
Entry
Vapar_0192        CDS       T00916                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0192
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N
Motif
Other DBs
NCBI-ProteinID: ACS16855
UniProt: C5CX51
Position
1:199429..200520
Genome map
AA seq 363 aa AA seqDB search
MGLPPSEIELLQSPVEGPLPCGEDLEYDPDFMALQQAATGKREQQFGSTIIPAEPPDWAR
VERIAKQLCQRTLDVRVLVLLTLAWTESRGLPGYVDGLRVVDGILQKFWNDVHPRVVDGD
FEDPLPRMNALAALAEAEGLGRSVRDARLLEDAGASMSLRQVEALLDSSKADQIDYPGGI
GRLREVARRAQEKAAPAVVALHAALELLRRIRETSERALGQSWAPDFSRLERSLRTVVQL
LPEQAQPEPAEASQAAAQGHGSAPAAPSAQGAAALGHGASGARAASIKDIEISTRDDVQV
LLEKACQYMERTEPSHPAPMLIRRAQRLLDLNFFQIIEELVPEGLQKIESLAGRSLSGGS
AAE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggggttgccgccgagcgagatcgaactactgcagtcgcctgttgaaggcccgcttccg
tgcggtgaagacctcgaatacgaccccgatttcatggcgttgcagcaagcggcaacggga
aagcgggagcagcagttcggctcgaccatcattccggccgagccgcccgactgggcccgc
gtcgagcgcattgccaagcagctgtgccagcgcacgctcgacgtgcgcgtgctggttctg
ctgacgctggcgtggaccgagagccggggattgccgggctacgtcgatggcttgcgcgtg
gtggacggcatcctgcagaagttctggaacgacgtgcatccgcgcgttgtcgatggcgat
ttcgaagacccgctgccgcgcatgaatgcgctggctgcattggccgaagccgaggggctc
gggcgcagcgtgcgcgatgcgcgcctgctcgaggatgccggcgcgtcgatgagcctgcgg
caggtcgaggccctgctcgactcgagcaaggccgaccagatcgattacccgggcggcatc
ggccggctgcgggaagtggcgcgccgcgcgcaggagaaggcggcgcccgcggtggtggca
ttgcatgcggcgctggagctgctgcggcgcatccgggagacctcggagcgggccctggga
cagagctgggcccccgatttctcccggctcgaacgctcgcttcgcaccgtggtccagctg
ctgcccgagcaggcccagccggagccggccgaagcatcgcaggcggcagcgcaaggccat
gggtcggcgccggccgctccttcggcgcagggcgctgcggccttgggccatggcgcctcc
ggtgcgcgtgcggcaagcattaaagatattgaaatatcgactcgtgatgatgtgcaggtc
ttgttggaaaaggcgtgccagtacatggaacgcaccgagcccagccacccggcccccatg
ctcatccgcagagcgcaaaggctgctggacctcaactttttccagatcatcgaagaactc
gttcccgagggcctgcagaagatcgaaagcctggccggccgctcgctgagcggcgggtcg
gcagcggagtga

DBGET integrated database retrieval system