KEGG   Variovorax paradoxus S110: Vapar_0195
Entry
Vapar_0195        CDS       T00916                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vap  Variovorax paradoxus S110
Pathway
vap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Vapar_0195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0195
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0195
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACS16858
UniProt: C5CX54
Position
1:202747..203229
AA seq 160 aa
MAVDMFMRVEGANGESKDSNHKDWTDIKSFAWGATQPGNMVSGGGGGVGKASFNDLQVLA
RIDKAAPSVMKNCASGKHLSKVEVSVCKAGGSQIEYTRVTLEEVLVTSVQYSAEQGGDAV
LVQFAFQAAKVKQQYWEQTDKGGKGAETVLAWNIKENREA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcagtagacatgttcatgcgcgtcgagggcgcgaacggcgaatccaaggactcgaac
cacaaggactggaccgatatcaagtcgttcgcatggggagcaacgcagcctggcaacatg
gtcagcggcggcggtggcggtgtgggcaaggcgagcttcaacgacctgcaggtgctcgcg
cgcatcgacaaggcggcgccgtcggtgatgaagaactgcgcgagcggcaagcacctgagc
aaggtggaagtgtcggtgtgcaaggccgggggctcgcagatcgaatacacgcgcgtgacg
ctggaagaagtgctggtcacctcggtgcagtactcggccgagcagggcggcgatgcggtg
ctggtgcagttcgccttccaggcggccaaggtcaagcagcagtactgggagcagaccgac
aagggcggcaagggcgctgaaaccgtgctggcctggaacatcaaggaaaaccgggaagcc
tga

DBGET integrated database retrieval system