KEGG   Variovorax paradoxus S110: Vapar_0199
Entry
Vapar_0199        CDS       T00916                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0199
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0199
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ACS16862
UniProt: C5CX58
Position
1:206635..207801
AA seq 388 aa
MSMRTTAELADDSQQAPPAAIEHAAPEHAAAPARRGAAEADPVLWAGLVDQPFEHDLFML
LRRLDAHGSHPLLGRAPRPLDEPLRLGQEPSMAFAPSNVSGVDVDGDGPPRISIYGFGLF
GPNGPLPLHLTEYARERKRHHSDNTLSAFADLFHHRLILLFYRAWADAQSVNSLDRPDGH
RFVDYVASLMNMGQPGLKARDRIADHARTFMAGHLVRQTRNPEGLIQILRLYFDVPVRVE
EFVSDWVMLDEREISRIGTSGRNQKLGAGATVGLAVRDAQGKFRLELGPLSQREFRDFLP
GSKRLQQVVDWVRQYVGIEFAWELRLVLKKQEALGMQLGSDQRLGWGSWLGTRLSPTDAG
DMLFQPEALYSRSASAASAAAEASSMAL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgagcatgcgcaccacggccgagctcgccgacgattcgcagcaggcgccgccggctgcg
atcgagcatgccgcgcccgagcatgccgcggcacccgcgcggcgcggtgcggccgaagcc
gatccggtcctgtgggccggcctggtcgaccagcctttcgagcacgacctgttcatgctg
ctgcgccgcctcgatgcgcacggcagccatccgctgctgggccgcgcgccgcgcccgctc
gacgagcctttgcggctgggccaggagccgtcgatggcctttgcgccctcgaacgtctcg
ggcgtcgatgtcgacggcgacggcccgccgcgcatctcgatctacggcttcggcctgttc
ggccccaacgggccgctgccgctgcacctgaccgagtacgcgcgcgaacgcaagcgccac
cacagcgacaacacgctcagcgccttcgccgacctgttccaccaccggctcatcctgctg
ttctaccgggcctgggccgatgcccagtcggtcaacagcctggaccgccccgacggccac
cgcttcgtcgactacgtggccagcctcatgaacatggggcagccgggcctcaaggcgcgc
gaccgcatcgccgaccatgcgcgcaccttcatggccgggcacctcgtgcgccagacgcgc
aaccccgaggggctgatccagatcctgcggctgtatttcgacgtgcctgtgcgcgtcgag
gagttcgtgagcgactgggtgatgctcgacgagcgcgagatcagccgcatcggcacttcc
gggcgcaaccagaagctgggcgccggcgccaccgtcgggctggcggtgcgcgatgcgcag
ggcaagttcaggctcgaactcgggccgctctcgcagcgcgagttccgcgacttcctgccg
ggcagcaagcgcctgcagcaggtggtcgactgggtgcgccagtacgtgggcatcgagttc
gcgtgggagctgcgcctcgtgctcaagaagcaggaagccctcggcatgcagctgggcagc
gaccagcgcctgggctggggcagctggctcggcacgcgcctctcgcccaccgacgccggc
gacatgctgttccagcccgaagccctgtattcccgttccgcatcggctgcttccgcggcg
gccgaagcctcttccatggccttatga

DBGET integrated database retrieval system