KEGG   Variovorax paradoxus S110: Vapar_0201Help
Entry
Vapar_0201        CDS       T00916                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vap  Variovorax paradoxus S110
Pathway
vap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Vapar_0201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0201
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD
Motif
Other DBs
NCBI-ProteinID: ACS16864
UniProt: C5CX60
Position
1:210545..212878
Genome map
AA seq 777 aa AA seqDB search
MARVVRAHTPLGEDQLQFRSMHGTEGLSQLFEFEVDLLSPSASIDMKAVLGKPMALEIQT
AGTPRFLNGQVVRFSMIGREGGTSRHTVYRASVRPWLWYLTRSSDNKIFQNKTVVEVLED
VFGDYNFAFEKKLTGTYRQWEHCVQYNETDFAFVSRLMELEGIYYYFKHDKNQHTLVLTD
DVTMHEPMSGYETINYFAADRDVTEDMEVIDNWQVTAEIRSGSYAVDDYNFTTPGADLSG
ARSMPQPYDHSGYEMYEWLGEYTNPGEGEHYARVRLEEAQSMAERSVGHATVRGMAPGYT
FSMQNSPRSDDNREYLIVSVNYMLREGGYATGAAPGEYSFNFVVQPTSLPFRAPRITQIP
RTTGPQTAVVVGPEGEEIWTDQYGRVKVQFRWDRSGRRNENCSCFVRVSHVIAGDGFGAV
FTPRIGQEVVIDFVDGRADRPLVVGRVYNPRQMPPFNLPGEQTKSGFVTRSTPGGSPETA
NSLVFEDKMGAEYVALHAERDLNVSVEKNETHDTGGTRTTVIVGHESATYKAGEERHITE
GAVETIDGGETRTVTGGATETVSGGETRTISDGATETISGGETRTVSGGFTETISGGATE
TISGGVNSTITGGVTQTITGGVNETISGGLTFMVNGGVTSNVLGNHTHVVTGGSTTTTTG
PTINNAPDIVDNSDRRTINAGDNTVNAAKEGWWRNTDNHGTLEHTGVNVAAVDVNGVKLQ
FSGVNGQFNGVFINLSVTSIIDAKFKYKLNPVGISTVGLSLKTGYIAVAFKSLFMKA
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggccagagtcgtacgagcgcacaccccgcttggggaagaccagctccagttccgctcg
atgcatggcaccgagggactgtcgcagttgttcgaattcgaggtcgacctgctgagcccg
agcgcgtcgatcgacatgaaagcggtgctcggaaaacccatggccctggagatccagaca
gccggcacgccccgtttcctgaacggccaggtggtccgcttctccatgatcggacgcgaa
ggcggtacctcgcgccacaccgtctatcgtgcttcggtgcgcccatggctctggtatctc
acgcgctccagcgacaacaagatcttccagaacaagacggtcgtcgaagttctcgaggac
gtattcggcgactacaacttcgccttcgagaagaagctcaccggcacctatcgccagtgg
gagcactgcgtgcagtacaacgagacggactttgccttcgtgagccggctcatggaactc
gaaggcatctactactacttcaagcacgacaagaaccagcatacgctggtgctgaccgac
gacgtcacgatgcacgagccgatgtccggctacgaaaccatcaattacttcgcggccgat
cgcgacgtgaccgaggacatggaggtcatcgacaactggcaagtgacggccgagatccgc
tcgggcagctatgcggtggatgactacaacttcaccacgccgggcgccgatctgagcggt
gcccgctccatgccgcagccgtacgaccactcgggctatgagatgtacgagtggctcggc
gagtacacgaaccccggggaaggcgagcactatgcgcgcgtgcggctggaagaagcgcag
tcgatggccgagcgcagcgtgggccatgccacggtccggggcatggcgcccggctacacc
ttctcgatgcagaactcgccgaggtcggacgacaaccgcgagtacctgatcgtttcggtg
aactacatgctgcgcgaaggcggctacgccaccggagccgcaccgggcgaatacagcttc
aactttgtcgtccagccgacgtccctgcccttcagggcaccccggatcacgcaaatcccc
aggaccaccggtccgcagaccgcggtggtggtcggccccgaaggcgaggaaatctggacc
gaccagtacggccgcgtcaaggtgcagttccggtgggaccgcagcgggcgccgcaacgag
aactgctcgtgcttcgtgcgtgtgtcccatgtcatcgcaggcgacggcttcggtgctgtt
ttcacgccgcgcatcggccaggaagtggtgatcgatttcgtcgacgggcgggccgaccgg
ccgctcgtcgtggggcgggtctacaacccgcgccagatgccacccttcaatctgccgggc
gagcagaccaagagcgggttcgtcacgcgttctacgccgggcggctcgccggaaaccgcc
aactcgctcgtcttcgaagacaagatgggcgctgaatacgtagcgcttcatgcagagcgc
gacctgaatgtctcggtggagaagaacgagacccacgacaccggtggcacgcgcacgacc
gtcatcgtggggcatgaatcggccacctacaaagccggcgaagaacgtcatatcaccgag
ggcgcggtggagacgatcgacggcggagagactcgcacggtgaccggcggagcgaccgag
acagtttccggcggcgagacgcggacgatttcggacggcgcgaccgagacgatcagcggc
ggcgaaacgcgcactgtcagcggagggttcacggaaaccatcagcggtggtgcgaccgag
acgatcagtggaggtgtgaactcgacgatcaccggcggcgtgacccagacgatcacgggc
ggcgtgaacgagaccatcagcggcggccttaccttcatggtgaatggcggggtcaccagc
aacgtcctgggcaaccacacgcatgtcgtcacggggggcagcacgaccaccacgaccgga
cccacgatcaataacgcgccggacattgttgacaactcggacaggcggacgatcaatgcg
ggcgacaacaccgtcaacgcagccaaggaaggctggtggcgcaacacggacaaccacgga
acgctcgaacatacgggcgtcaatgtggcggcagtcgatgtcaatggcgtgaagctgcaa
ttctcgggggtgaacggccagttcaacggcgtcttcatcaacctgtccgtgaccagcatc
atcgatgcgaagttcaaatacaagctcaatcccgttggcatctcgacagtcggactcagt
ctcaagaccggctacatcgcagtggcattcaagagccttttcatgaaggcctga

DBGET integrated database retrieval system