KEGG   Variovorax paradoxus S110: Vapar_0514
Entry
Vapar_0514        CDS       T00916                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0514
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0514
SSDB
Motif
Pfam: T6SS_VasE GHMP_kinases_C
Other DBs
NCBI-ProteinID: ACS17177
UniProt: C5CK79
Position
1:563214..564545
AA seq 443 aa
MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGFAEIEIDQAALTLGKL
ALVRAVGLFGDGTVFDMPAVDPLPEPIDIPPAMRDEAVVLALPLRRAGAREADAEDYEEL
VRHRVLESEVPDSNTAGERTAVLQLGQLHTRLMRASEATDAWTTLGVARVLERRVDNQVQ
LDRAMLPPLLDVAGHAVIRSWLDELLGLLRQRGEALAGRMTQGGTGGVAEIADFMLLQTV
NRNEAVFAHLAQSAMLHPQHFFEHALGLAGDLASFRDSRRVTRFGPYVHDDLALSFRPLM
DDLRRSLSMVLEQSAIRIDLHDRKHGVRVAVVTDVELQRKATFVLAVNANMPSEALRARF
PTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHTGANYFELETRNSDLWRQLEQS
GGIAMHIAGDFPGLDLAFWAIRS
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagttggcgaacaaaagtggtctggagcgaggggatgctgctgcagccccagcacctg
cagcaaagcgagcgtcatgccgaccatgcgaggcatgtgctgctgcgttccaccacgccc
tatgcctggggattcgcggagatcgagatcgatcaggccgcgctcacgctgggcaagctc
gcgctggtgcgggcggtgggcctgttcggcgacggcacggtgttcgacatgccggcggtc
gatccgctgcccgagcccatcgacattccgcccgccatgcgcgacgaggccgtggtgctg
gcgctgccgctgcgccgcgccggtgcccgcgaggccgatgccgaagactatgaagagctg
gtgcgccaccgcgtgctcgagtccgaggtgcccgactccaacaccgcgggcgagcgcacc
gccgtgctgcagctgggccagctgcacacgcgcctgatgcgcgccagcgaagccaccgat
gcctggaccacgctgggcgtggcgcgcgtgctggagcgccgcgtcgacaaccaggtgcag
ctcgaccgcgcgatgctgccgccgctcttggacgtggcgggccatgccgtgatccgttcc
tggctcgacgagctgctgggcctcttgcgccagcgcggcgaggcgctggccggccgcatg
acgcaaggcggcaccggcggcgtggccgagatcgccgacttcatgctgctgcagaccgtc
aaccgcaacgaggcggtcttcgcgcacctggcccaaagcgccatgctgcatccgcagcac
ttcttcgagcatgcgctcgggctggccggcgacctggcgagctttcgcgattcgcgccgc
gtcacgcgcttcggcccctacgtccacgacgacctggcgctgagcttccgtccgctgatg
gacgacctgcggcgcagcctctcgatggtgctggagcagtcggccatccgcatcgacctg
cacgaccgcaagcacggcgtgcgcgtggcggtggtgaccgacgtggagctgcagcgcaag
gcgaccttcgtgctcgcggtgaatgccaacatgccgagcgaagcgctgcgcgcgcgcttt
cccacgcaggtcaagatcggcccggtcgagcgcatccgcgacctcgtgaacctggcgctg
ccgggcgtcacgctcacgccgatgcccgtggcgccaaggcagattcccttccacaccggc
gccaactacttcgagctcgaaacgcgcaacagcgacctgtggcgccagctggagcaatcg
ggcggcatcgcgatgcacatcgcgggcgacttccccggcctcgacctcgcgttctgggcc
attcgttcctag

DBGET integrated database retrieval system