KEGG   Variovorax paradoxus S110: Vapar_0531
Entry
Vapar_0531        CDS       T00916                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vap  Variovorax paradoxus S110
Pathway
vap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Vapar_0531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0531
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0531
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: ACS17194
UniProt: C5CK96
Position
1:587530..590541
AA seq 1003 aa
MADHEFRIETDSPAKDDLMFWRIVGHEALARPSAYELTVLSKNKALDAKDILGRAFDVVI
QFQDKDGGVHERHCQGHAVRFVRAGHVGRHFEYRVTLRSWFWLLTKRTNSRILQDKKVLE
VLDAVFEDSPIKRFKKTKAGNVIGTHTPRRYCVQHQENDYQFLSRLLEDEGIYYWFDAHD
APGTMHLSDASDLAHEKLPVEGTLRYMSSDASEARHNEISRWVSARQFDTGKQASRDSDF
KAIKKKLAATIDVKDDHELADFEEFEFPGGYFTGDDGENRTKLRGDELNARRDRHWALTT
WPDVAAGRSFKFEGDPDGTRNGDYVIAACTFMASHPGYESVGAGTAVPQDLRTALAGVLR
DDAVNADTLQVLEDLIASTPMLSTSQPGTSAFLITAIPMERAYRPPRLTPRVTMPGPQTA
IVVGPAGDELHVDEHGRVKVHFHWDRYDESNEKSTCWVRVSQPWSGKGWGGYFIPRIGQE
VIVDFINGDPDRPIVVGRVYNDDQPIPYKSPTQSGFKTRSTPGGGPANYNEIMFEDKKGE
ENINIHAERNMSRSVERDDSTTVGRDQSLVVERDQSGIVQRDQSLAVTRNRSIHVKNNES
HIVDVNQSLKVIGNQENKIVGNQVTTVDGVHQVEAKGDIRTKTSGNRIDHTTGNETRKVS
GNQTFTVSGNMGFKAATIVMETPHFEWKITGANSAVMAVPSGPYSIMANKFSVLSNTDAS
ILAVGKINQTSIENNVTVMGNNNSGYVGMASETNMGLARSTFLGVAIDTFMGASISNTLA
LQFEAVAAAKLSIAVGPHIEMNSMKMYVPGGGAAGGGATVLSEGAEFLAIVGVLEGVNVG
FMSSVIGFAELSDQYSDAKAELAQAARDAAAAGHPGLAARLNRLATDGAGTMDKDAPTST
QNTRGDAFSSDYDPFAVPDGGSSSDPSAGGDGPTSSEPSSSEPSSSGPSSSEPTSSEPSS
SEPSSSEPSSSEPSSSEPSSSGPSSSGPSSSEPNSSEPNSSGF
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggccgatcacgagttccgcatcgagacagattcacccgccaaggacgacctgatgttc
tggcgcatcgtgggccacgaggcgctggcgcgcccgtcggcctacgagctcacggtgctg
tcgaagaacaaggcgctcgatgccaaggacattctcggccgcgctttcgacgtggtcatc
cagttccaggacaaggacggcggcgtgcacgagcgccactgccagggccacgccgtgcgc
ttcgtgcgggccgggcatgtgggcaggcatttcgaataccgcgtcacgctgcgctcgtgg
ttctggctgctcaccaagcgcaccaactcgcgcatcctgcaggacaagaaggtgctcgag
gtgctcgacgcggtcttcgaagacagcccgatcaagcgcttcaagaagaccaaggccggc
aacgtcatcggcacccacacgccccggcgctactgcgtgcagcaccaggagaacgactac
cagttcctctcgcgcctgctggaggacgaaggcatctactactggttcgacgcgcacgac
gcgcccggcaccatgcacctgtcggacgcgagcgacctggcgcacgagaagctgccggtg
gaaggcacgctgcgctacatgtccagcgacgcgagcgaggcgcgccacaacgagatctcg
cgctgggtgagcgcacgccagttcgacaccggcaagcaggcctcgcgcgacagcgacttc
aaggcgatcaagaagaagctggctgccaccatcgatgtgaaggacgaccacgaactcgcc
gacttcgaggagttcgaattcccgggcggctacttcacgggcgacgacggcgagaaccgc
accaagctgcgcggcgacgagctcaacgcgcgccgcgaccgccactgggcgctgaccacc
tggcccgacgtggccgcggggcgcagcttcaagttcgagggcgaccccgacggcacacgc
aacggcgactacgtgatcgcggcctgcaccttcatggcaagccaccctggctatgaaagc
gtgggcgccggcacggccgttccacaggacctgcgcacggcgctggccggcgtgctgcgc
gacgatgcggtgaacgccgacacgctgcaggtgctggaagacctgatcgccagcacgccg
atgctcagcacctcgcagccgggcaccagcgcattcctgatcaccgcgataccgatggag
cgggcctaccggccgccgcgcctcacgccgcgcgtgaccatgcccggtccgcagacggcc
atcgtggtcggccccgcgggcgacgagctgcacgtggacgagcacggccgcgtgaaggtg
cacttccactgggaccgctacgacgagagcaacgagaagtcgacctgctgggtgcgcgtg
tcgcagccctggagcggcaagggctggggcgggtacttcattccgcgcatcggccaggag
gtgatcgtcgatttcatcaacggcgaccccgaccggccgatcgtcgtgggccgcgtctac
aacgacgaccagcccattccctacaagtcgcccacgcagagcggcttcaagacccgctcc
acgcccggcggcggtcccgcgaactacaacgagatcatgttcgaggacaagaagggcgag
gagaacatcaacatccatgcggagcgcaacatgagccgcagcgtggagcgcgacgattcc
accaccgtgggccgcgaccagagcctggtggtcgagcgcgaccagagcggcatcgtccag
cgtgaccagagcctggccgtcacgcgcaaccgcagcatccacgtcaagaacaacgagtcg
cacatcgtcgacgtcaaccagagcctgaaggtcatcggcaaccaggaaaacaagatcgtc
ggcaaccaggtcaccacggtggacggcgtgcaccaggtcgaggccaagggcgacatccgc
accaagacctcgggcaaccgcatcgaccacaccacaggcaatgaaacgcgcaaggtaagc
ggcaaccagaccttcaccgtctccggaaacatgggcttcaaggcggccaccatcgtgatg
gaaacgccgcacttcgaatggaagatcaccggtgccaattccgcggtgatggcggtgccc
agcggcccctactcgatcatggcgaacaagttcagcgtgctgagcaacacggacgcctcg
atcctggcggtcggcaagatcaaccagacgtcgatcgagaacaacgtcacggtcatgggg
aacaacaacagcggctacgtcggcatggcgagcgagacgaacatggggctggcccgcagc
acctttctcggcgtggccatcgacaccttcatgggtgcgagcatcagcaacacgctggcg
ctgcagttcgaggcggtggccgccgccaagctgagcatcgcggtggggccgcacatcgag
atgaattcgatgaagatgtacgtgcccggtggaggggccgccggcggcggcgccacggtg
ctgagcgagggcgcggagttcctggcgatcgtcggcgtgctggaaggggtgaacgtgggc
ttcatgtcctccgtcatcgggttcgccgagctgtcggaccagtacagcgatgccaaggcg
gaactggcgcaggcggcccgggatgccgccgctgccgggcacccgggcctggccgcgcgc
ctgaaccgcctggccaccgacggcgcgggcaccatggacaaggacgcgccgacgagcacc
cagaacacccggggcgacgccttctcatcggactacgacccctttgccgtgcccgacggc
ggatcttccagcgatccatccgccggcggcgacgggccgacctcgtcggagcccagctcg
tcagagcccagttcatccgggcccagctcgtccgagcccacttcgtcggagcccagctcg
tcagagcccagttcgtccgagcccagttcgtccgagcccagttcgtccgagcccagttca
tccgggcccagctcatccgggcccagctcatcagagcccaattcgtccgaacccaattcc
tccggtttctga

DBGET integrated database retrieval system