KEGG   Variovorax paradoxus S110: Vapar_0536
Entry
Vapar_0536        CDS       T00916                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vap  Variovorax paradoxus S110
Pathway
vap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Vapar_0536
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vap02044]
    Vapar_0536
Secretion system [BR:vap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vapar_0536
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ACS17199
UniProt: C5CKA1
Position
1:595488..597866
AA seq 792 aa
MADHEFRIESDSPANGELMFWRIVGHEALARSSSYELTVLSKNHALDAKDILGRAFDVVI
QFQDKDGGMHERHCQGHAVRFERTGHVGRHFEYRIGLRSWFWLLTKRINSRILQEKKVLE
VLDAVLEDSPIRRFKKTRTSNVIGTHNPRRYCVQHQESDYQFLSRLLEDEGIYYWFDAHD
APGTMHLSDASDIAHDKLPVEGTLRHMATDTTEARHNEISRWVSARQFDTGTYASRDSDF
KAIKKKLEAAGGQPDKHELAEFEAFEFAGGYFTGADADDKGKLRGEEIAARRQRHWALTT
WPDVAAGRSFTFEGDPDGTRDGDYVIAACIFAASHPGYESIPHATPRMPIEQALREALDD
DAVNAQARPALEALIADAPALRTDLQGTSAFLITAIPVDVPFRPPRLTPRVVMPGPQSAI
VVGPAGEEIHADDFGRVKVHFHWDRYDKSDEKSTCWVRVSQPWAGKGWGGYFIPRIGQEV
IVDFLNGDPDRPIIVGRVYNDDQPIPFGSHTQSGFRTRSTPKGSASNCNEFRFEDKKGSE
QVYLHAEKNQDIEVENNETHWVGHDRTKTIDHDETTHVKHDRTETVDNNETITVHGQRTE
TVDKNETITIHQNRTETVDLNETISIGQNRSITVGASETATVALQRTHSVGINETITVGA
AQEITVGAMQAVTVGASQTINVGANQSSSIGANRSVDVGADLSTTVGKNESRSVGEGRTS
SVGKDDALTVGKNLVIDAGDSISIKTGSASITMKKDGTIVIKGKDITIDGSGKINVKASS
DVVIKGSKILQN
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggccgatcacgagttccgcatcgaaagcgattcgcccgccaacggcgagctgatgttc
tggcgcatcgtgggccatgaggcgctcgcgcgctcgtcgagctacgaactcaccgtgctg
tccaagaaccatgcgctcgatgccaaggacatcctcggccgcgccttcgacgtggtcatc
cagttccaggacaaggacggcggcatgcacgagcgccattgccagggccacgccgtgcgc
ttcgagcgcaccggccacgtgggacggcacttcgaataccgcatcggcctgcgctcgtgg
ttctggcttctcaccaagcgcatcaactcgcgcatcctgcaggaaaagaaggtgctcgaa
gtgctcgacgcggtccttgaagacagcccgatcaggcgcttcaagaagaccaggaccagc
aacgtcatcggcacccacaacccgcgccgctactgcgtgcagcaccaggaaagcgactac
cagttcctgtcgcggctgctggaagacgaaggcatctactactggttcgacgcgcacgat
gcgcccggcaccatgcacctgtcggacgccagcgacatcgcgcacgacaagctgcccgtg
gagggcacgctgcgccacatggccaccgacaccaccgaggcgcgccacaacgagatctcg
cgctgggtgagcgcacgccagttcgacaccggcacctacgcctcgcgcgacagcgacttc
aaggccatcaagaagaagctcgaggccgcgggcggccagcccgacaagcacgagctggcc
gaattcgaggccttcgagtttgccggcggctacttcacgggtgcggatgcggacgacaag
ggcaagctgcgcggcgaggagatcgccgcgcgccgccagcgccactgggcgctcaccacc
tggcccgacgtggcggcggggcgcagcttcaccttcgagggcgaccccgacggcacgcgc
gatggcgactacgtgatcgccgcctgcatcttcgcggcgagccacccgggctacgagagc
attccccatgccacgccgaggatgcctatcgagcaggcgctgcgcgaggcgctcgacgac
gacgccgtcaatgcccaggcgcggcccgcactcgaggcgctgatcgccgacgcgcccgcg
ctgcgcaccgacctgcagggcaccagtgccttcctgatcaccgcgattcccgtcgacgtg
ccgttccgcccgccacgcctcacgccgcgcgtcgtcatgcccgggccgcaatcggccatc
gtggtggggccggccggcgaagagatccacgccgacgacttcggccgcgtgaaagtgcac
ttccactgggaccgctacgacaagagcgacgagaagtccacctgctgggtgcgcgtgtcg
cagccctgggcgggcaagggctggggcgggtacttcattccgcgcatcgggcaggaggtg
atcgtcgacttcctgaatggcgatcccgaccggccgatcatcgtgggccgcgtctacaac
gacgaccagccgatccccttcggctcgcacacgcagagcggctttcgcacgcgctccacg
cccaagggcagcgcgtccaactgcaacgagttccgcttcgaggacaagaagggttcggag
caggtgtacctgcacgccgaaaaaaaccaggacatcgaggtcgagaacaacgagacccat
tgggtgggccacgaccgcaccaagaccatcgaccacgacgagaccacgcacgtcaagcac
gatcgcaccgagacggtcgacaacaacgagaccatcaccgtgcacggccagcgcaccgaa
acggtggacaagaacgagaccatcacgatccaccagaaccgcacggagacggtggacctg
aacgagaccatctccatcggccagaaccgctcgatcacggtgggtgcgagcgagacggcc
acggtggcactgcagcgcacgcattcggtggggatcaacgagaccatcaccgtgggcgcg
gcgcaggagatcacggtgggggcgatgcaggcggtgacggtgggggcgagccagacgatc
aatgtgggcgcgaaccagtcgagcagcatcggggcgaaccggtcggtggatgtgggggcg
gacctttccaccaccgtgggcaagaacgagtcgcgcagcgtgggcgaagggcgcacatcc
agcgtgggcaaggacgacgcgctcacagttgggaagaacctcgtgatcgatgcgggcgac
tccatctccatcaagacaggcagcgccagcatcacgatgaagaaggacgggaccattgtg
atcaagggcaaggacatcacgatcgatggctccggaaagatcaacgtcaaggccagcagc
gacgtggtgatcaagggctcgaagatcttgcagaactga

DBGET integrated database retrieval system