KEGG   Variovorax paradoxus S110: Vapar_0576Help
Entry
Vapar_0576        CDS       T00916                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00260  Glycine, serine and threonine metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_0576
Enzymes [BR:vap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Vapar_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACS17239
UniProt: C5CKE1
Position
1:630929..631987
Genome map
AA seq 352 aa AA seqDB search
MTDRSLLVDLRSDTVTQPTPAMREAMMAAPLGDDVFGTDPSVNALQEKIAALLGFEAALL
VPTGTQSNLCAILSHCGRGDEYIVGQQAHCYRWEGGGAAVFGSVQPQPLDHAPDGTLPLA
QIEAAIKPDDAHFARTRLLALENTLGGKLLPFEYVQAATDLAKSRGLQRHLDGARLFNAA
TAQAALNKNGDVRTEARRIAQCFDSVSVCFSKGLGAPIGSALVGSREFIARAHRIRKMAG
GGMRQAGLLAAAASHALDHHIDRLADDHALARRLAEGLEGIEGLKVEAPHTNIVFVDLMG
AAQARSAELLANLNGQGILATGLYRLRFVTHLDVDAAGVDRAVAAIRGFFNA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccgctccttgctcgtcgacctgcgcagcgacaccgtcacgcagcccaccccg
gcgatgcgcgaggccatgatggcggcgccgctcggcgacgacgtcttcggcaccgatccg
agcgtcaacgcgctgcaggaaaagatcgccgcgctgctgggcttcgaggcggcgctgctg
gtgccgacgggcacgcagagcaacctgtgcgcgatcctttcgcactgcgggcgcggcgac
gagtacatcgtcggccagcaggcccactgctaccgctgggaaggcggcggcgccgcggtg
ttcggcagcgtgcagccgcagccgctcgaccacgcacccgacggcacgctgccgcttgcg
cagatcgaagccgccatcaagcccgacgacgcgcacttcgcgcgcacacgcctcctggca
ctggagaacacgctgggcggcaagctgctgcccttcgaatacgtgcaggcggcaaccgac
ctggcgaagagcagggggctgcagcggcacctcgatggcgcgcggctcttcaatgccgcc
accgcgcaggccgcgctgaacaagaacggcgacgtccgcaccgaagcgcgccgcatcgcc
cagtgcttcgacagcgtgtcggtctgcttcagcaagggcctgggcgcacccatcggctcg
gcgctggtcggttcgcgcgaattcatcgcgcgggcgcaccgcatccgcaagatggcgggc
ggcggcatgcggcaggccggcttgcttgctgcagccgcttcgcatgcgctcgaccaccac
atcgaccgcctcgccgacgaccatgccctggcccgtcgcctggccgaggggctcgagggc
atcgagggcctgaaggtcgaggcgccgcacacgaacatcgtgttcgtcgacctcatgggc
gcggcgcaggcgcgttcggccgaactgctcgcgaacctcaacgggcagggcattcttgcc
accggcctctatcggctgcgcttcgtgacgcacctcgatgtcgatgcggccggcgtcgac
cgcgccgtggcggccatccgcggcttcttcaacgcctga

DBGET integrated database retrieval system