KEGG   Variovorax paradoxus S110: Vapar_1096Help
Entry
Vapar_1096        CDS       T00916                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00030  Pentose phosphate pathway
vap00480  Glutathione metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
Module
vap_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vap_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
vap_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Vapar_1096
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Vapar_1096
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vap04147]
    Vapar_1096
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Vapar_1096
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Vapar_1096
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Vapar_1096
  Exosomal proteins of colorectal cancer cells
   Vapar_1096
  Exosomal proteins of bladder cancer cells
   Vapar_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACS17747
UniProt: C5CPM6
Position
1:complement(1200923..1202389)
Genome map
AA seq 488 aa AA seqDB search
MSFDLVLFGGTGDLAWRKLMPALFQAFRHGSLPKDGRIVGVARDDLSDDQYRELIQSRFN
AVEGAKRPSAEEFEKFASLLHYLRMDLSKPADYARLSDLLKQRNADTVVMYVATAPALFT
QVVEQIAAAGLNGPSTRVVLEKPLGHDLASNRAINAAVCKVLDEKQVFRIDHYLGKPSVQ
NLFAMRFGNALFEPIWRREHIANIQITIAEDLGVEKRGAFYDQTGALRDMVQNHALQLVC
AIGMEPPINSHADAIRDEKLKVLRALKPWTPETLGLHAIRGQYTAGTAYGERVPGYKDEP
GVDPESRTETFVALRTEIANWRWAGVPLYIRTGKRLASRDARIEVNFRPTPHAIYRAPAG
AVNKLVINLQPRDGLELHMLAQAQDNRRSNGHQSAAQLAPVQLDLDFDKRFGAERVGAYE
RLLLDVIDGRLNLFVRSDEQEEAWRWVEPLIDSWASDGGPRPYAAGTWGPSASSAMIARD
GFSWSEEQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgatctcgttctgttcggcggcactggcgatctcgcatggcgcaagctgatg
cccgcgctgttccaggccttcaggcatggcagcctcccgaaagacggacgcatcgtcggc
gtggcccgcgacgacctctcggacgaccagtaccgcgaactgatccagtcgcgcttcaat
gccgtcgaaggcgccaagcgcccttcggccgaggagttcgagaagttcgcctcgctgctg
cactacctgcgcatggacctgtccaagccggccgactacgcacgcctttccgacctgctc
aagcagcgcaatgccgacacggtggtgatgtacgtggccacggcgcccgcgctcttcacg
caggtggtcgagcagatcgccgcagccggcctgaacggcccgtcgacccgcgtggtgctc
gaaaagccgctgggccatgacctggcgtccaaccgcgcgatcaatgccgcggtgtgcaag
gtgctcgacgagaagcaggtcttccgcatcgaccactacctgggcaagccctcggtgcag
aacctgttcgccatgcgcttcggcaatgcgctgttcgagcccatctggcgccgcgagcac
attgccaacatccagatcaccatcgccgaggacctgggcgtcgaaaagcgcggcgccttc
tacgaccagaccggcgcgctgcgcgacatggtgcagaaccatgcgctgcagctggtctgc
gcgatcggcatggagccgccgatcaactcgcatgccgacgccatccgcgacgagaagctc
aaggtgctgcgcgcgctcaagccctggacgcccgagacactggggctgcatgccattcgc
ggccagtacaccgccggcacggcgtacggcgaacgcgtgccgggctacaaggacgagccc
ggcgtcgaccccgaaagccgcaccgagaccttcgtggcgctgcgcacggaaatcgccaac
tggcgctgggccggcgtgccgctgtacatccgcaccggcaagcggctggcctcgcgcgac
gcgcgcatcgaggtcaacttcaggcccacgccgcatgcgatctaccgcgcaccggccggc
gccgtcaacaagctggtgatcaacctccagccccgcgacggcctggaactgcacatgctc
gcgcaggcgcaggacaaccgccgcagcaacggccaccagagcgccgcgcagctcgcgccg
gtgcagctggacctcgacttcgacaagcgcttcggcgccgagcgcgtgggcgcctacgaa
cggctgctgctcgacgtgatcgacggccgcctgaacctgttcgtgcgcagcgacgagcag
gaagaagcctggcgctgggtcgaaccgctgatcgacagctgggcatcggacggcgggccg
cgcccctacgccgcgggcacctgggggccgagcgcctcgagcgcgatgattgcgcgcgac
ggcttctcgtggagcgaggaacagtag

DBGET integrated database retrieval system