KEGG   Variovorax paradoxus S110: Vapar_1414Help
Entry
Vapar_1414        CDS       T00916                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00260  Glycine, serine and threonine metabolism
vap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01130  Biosynthesis of antibiotics
vap01230  Biosynthesis of amino acids
Module
vap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_1414
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vapar_1414
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vapar_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Peripla_BP_6 NMO PcrB
Motif
Other DBs
NCBI-ProteinID: ACS18065
UniProt: C5CSG7
Position
1:complement(1535486..1536343)
Genome map
AA seq 285 aa AA seqDB search
MGARAGRIAATFDALKKDGRRALIPYVTAGFPFADITPELMHGMVEAGADVIELGVPFSD
PMADGPVIQKAGEAALALGVGMKQVLAMVAAFRQKDAATPVVLMGYANPVERYDLVHGKK
AFIRDASAAGVDGLLVVDYPPEECEAFAADLKAAGIDLIFLLAPTSTSERMAQVARTASG
YVYYVSLKGVTGAGHLDTEAVGQMIPRIREHVSIPVGVGFGIRDARTAQAVGSAADAVVI
GTRIIQLIDGQPREKVVPAVREFLAGIREALDALPAATPKNAAGR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgggggcccgcgctggccgcattgccgccaccttcgacgcgctgaaaaaagacggccgc
cgcgccctgattccctacgtcaccgccggcttccccttcgccgacatcacgccggagctg
atgcacggcatggtcgaggccggcgccgacgtgatcgagctcggcgtgccgttctccgac
ccgatggccgatggcccggtgatccagaaggccggcgaggccgcgctggcgctgggcgtc
ggcatgaagcaggtgctcgccatggtggccgccttccgccagaaggacgcggcgacgccc
gtggtgctgatgggctatgcgaacccggtcgagcgctacgacctcgtgcatggcaagaag
gccttcatccgcgatgcgtcggctgcaggcgtcgacggcctgctggtggtcgactacccg
cccgaggaatgcgaggctttcgccgccgacctcaaggcggcgggcatcgacctgatcttt
ctgctcgcccccaccagcaccagcgagcgcatggcgcaggtcgcgcgcaccgccagcggc
tatgtctactacgtgtcgctcaagggcgtgacgggcgccggccacctcgacaccgaagcg
gtcggccagatgatcccgcgcatccgcgagcacgtgagcatcccggtgggcgtgggcttc
ggcatccgcgacgcgcgcacggcccaggccgtcggttcggccgccgatgcggtcgtgatc
ggcaccaggatcatccagctgatcgacgggcagccgcgcgagaaggtggtgcccgcggtg
cgcgaattcctcgccggcatccgcgaggcgctcgatgccttgccggcggctacccccaag
aacgcggctggccgataa

DBGET integrated database retrieval system