KEGG   Variovorax paradoxus S110: Vapar_1415Help
Entry
Vapar_1415        CDS       T00916                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00260  Glycine, serine and threonine metabolism
vap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01130  Biosynthesis of antibiotics
vap01230  Biosynthesis of amino acids
Module
vap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_1415
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vapar_1415
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vapar_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACS18066
UniProt: C5CSG8
Position
1:complement(1536415..1537692)
Genome map
AA seq 425 aa AA seqDB search
MRTNYQQPDATGHFGNYGGTFASETLTHAINELRDAYAKYKDDPAFLAEFHYELKHFVGR
PSPVYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQ
HGVATATICARYGLECVVYMGSQDVKRQSPNVYRMNLLGATVVPVESGSKTLKDALNEAM
RDWVTNVENTFYIIGTVAGPHPYPTMVRDFQSVIGTECIDQMPAMLAAQGITGEAEGRQP
DVVVACVGGGSNAMGIFHPYIPFEGTRLIGVEAAGEGLDSGKHSASILRGSPGVLHGNRT
YLLQNEDGQVTETHSISAGLDYPGVGPEHAYLADIGRAEYVGITDAEALEAFHYLCRTEG
IIPALESSHAVAYAMKLAKTMRPDQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGLS
VKGGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccaactaccagcaacccgacgccaccggccacttcggcaactacggcggcacc
ttcgcgagcgaaacgctcacccacgcgatcaacgagctgcgcgacgcctacgcgaagtac
aaggacgatccggccttcctcgccgaattccactacgaactcaagcacttcgtcggccgc
ccctcgccggtctaccacgcggcgcgcaccagccgcgagatgggcggcgcgcagatctac
ctgaagcgcgaagacttgaaccacaccggcgcccacaagatcaacaacgtgatcggccag
gcgatgctcgcgcgccgcatgggcaagccccgcgtgatcgccgaaaccggcgccggccag
catggcgtggccaccgccaccatctgcgcgcgctacggcctcgaatgcgtggtctacatg
ggcagccaggacgtgaagcgccagagccccaacgtctaccgcatgaacctgctcggcgcc
accgtggtgccggtggagtcgggcagcaagacgctgaaggacgcgctcaacgaggccatg
cgcgactgggtcacgaacgtggagaacaccttctacatcatcggcaccgtggccggcccg
cacccctacccgaccatggtgcgcgacttccagagcgtgatcggcacggagtgcatcgac
cagatgcccgccatgctcgcggcccagggcatcaccggcgaagccgagggccggcagccc
gacgtggtggtggcctgcgtgggcggcggcagcaacgcgatgggcatcttccatccctac
atcccgttcgaaggaacgcgcctgatcggcgtggaggccgcgggcgaagggctcgacagc
ggcaagcactcggcatccatcctgcgcggcagccccggcgtgctgcacggcaaccgcacc
tacctgctgcagaacgaggacggccaggtgaccgaaacgcacagcatcagcgccgggctc
gactatcccggcgtgggccccgagcacgcctacctggccgacatcggccgcgccgagtac
gtcggcatcaccgacgccgaggcactcgaagcctttcactacctgtgccgcaccgaaggc
atcattccggccctcgaatcgagccacgccgtggcctacgccatgaaactcgccaagacc
atgcggccggaccagtcgatcctcgtgaacctctcgggccgcggcgacaaggacatcggc
accgtcgccgacctgtcgggcgtcgacttctacgaccggccctcgatgcgcggcctgagc
gtgaagggaggcaagtga

DBGET integrated database retrieval system