KEGG   Variovorax paradoxus S110: Vapar_1869Help
Entry
Vapar_1869        CDS       T00916                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00630  Glyoxylate and dicarboxylate metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01200  Carbon metabolism
Module
vap_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Vapar_1869
Enzymes [BR:vap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Vapar_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACS18519
UniProt: C5CUU1
Position
1:2000665..2001984
Genome map
AA seq 439 aa AA seqDB search
MPQTLTEQLSREQQIAALEKEWATNPRWKGIKRGYSAADVVRLRGSFPIEHTLARRGAEK
LWELVNNEPYVNCLGALTGGQAMQQVKAGVKAIYLSGWQVAADANTYSSMYPDQSLYPVD
SVPTVVERINNTFRRADEIQWSKNVNPGDKGYVDYFAPIVADAEAGFGGVLNGFELMKAM
IKAGAGGVHFEDQLASVKKCGHMGGKVLVPTTEAVQKLIAARMAADVCGTPTLVIARTDA
EAADLITSDYDENDKPFLTGERTAEGFYKTKKGIDQAISRAIAYAHYADLVWCETGTPDL
EFAKRFADAVHKVHPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKYQFITLAGI
HSMWFNMFDLAQDYVQRGMSAYVEKVQEPEFAARDRGYTFVSHQQEVGTGYFDEVTTVIQ
GGKSSVTALTGSTEEEQFH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccccagaccctcaccgaacaattgagccgcgaacagcaaattgccgccctcgagaaa
gaatgggccaccaatccccgctggaagggcatcaagcgcggctacagcgccgccgacgtg
gttcgccttcgcggctccttccccatcgagcacacgcttgcgcgccgcggcgccgagaag
ctctgggagctggtgaacaacgagccctacgtcaattgcctcggcgcgctcacgggcggc
caggccatgcagcaggtgaaggccggcgtgaaggccatctacctgtcgggctggcaggtt
gccgcggacgccaacacctactcgtcgatgtaccccgaccagtcgctgtacccggtggac
tcggtgccgaccgtggtggagcgcatcaacaacaccttccgccgcgcggacgaaatccag
tggtccaagaacgtgaacccgggcgacaagggctatgtcgactacttcgcgcccatcgtc
gctgacgccgaagccggctttggcggcgtgctgaacggcttcgagctgatgaaggccatg
atcaaggccggcgccggcggcgtgcacttcgaagaccagctcgcctcggtcaagaagtgc
ggccacatgggcggcaaggtgctcgtgcccaccaccgaggccgtgcagaagctcatcgcc
gcgcgcatggccgccgacgtctgcggcacgccgacgctcgtgattgcccgcaccgacgcc
gaagccgccgacctcatcaccagcgactacgacgagaacgacaagcccttcctcaccggc
gaacgcaccgccgaaggcttctacaagaccaagaagggcattgaccaggccatcagccgc
gccattgcctacgcccactacgctgacctggtgtggtgcgaaaccggcacgcccgacctc
gagtttgccaagcggtttgccgacgcggtccacaaggtgcaccccggcaagatgctggcc
tacaactgctcgccgtccttcaactggaagaagaacctcgacgacgccaccattgccaag
ttccagaaggagctcggcgccatgggctacaagtaccagttcatcacgctggccggcatc
cactcgatgtggttcaacatgttcgatctggcgcaagactacgtgcagcgcggcatgtcg
gcctacgtcgagaaggtgcaggagcccgaattcgcggcgcgcgatcgcggttacaccttc
gtgtcgcaccagcaggaagtcggcaccggctacttcgacgaggtgaccacggtcatccag
ggcggcaagtccagcgtcacggcgctgaccggctcgaccgaggaagagcagttccactga

DBGET integrated database retrieval system