KEGG   Variovorax paradoxus S110: Vapar_1928Help
Entry
Vapar_1928        CDS       T00916                                 

Definition
(GenBank) transferase hexapeptide repeat containing protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00520  Amino sugar and nucleotide sugar metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Vapar_1928
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vap01005]
    Vapar_1928
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     Vapar_1928
Lipopolysaccharide biosynthesis proteins [BR:vap01005]
 Unusual sugar
  Vapar_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ACS18575
UniProt: C5CVC6
Position
1:2062273..2062863
Genome map
AA seq 196 aa AA seqDB search
MTYKAHPTAIIDEGARIGDGTRIWHWVHVSAQATIGEGCSLGQNVYVGNDVTVGRNVKIQ
NNVSVYDAVTLEDDVFCGPSMVFTNVYNPRSAVTRKDEYRRTLVKRGATLGANCTIVCGN
TVGEYAFVGAGAVINRNVPAYALMVGVPAKQIGWMSEFGEQLALPLQGRAEAVCEHTGAR
YVLDGNAVTKLEAKTP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaggctcaccccacagcaatcatcgatgaaggtgctcgcattggcgatggc
acgcgcatctggcactgggtacacgtcagcgcacaggcgaccattggcgaggggtgctcg
ctcggccagaacgtctacgtaggcaacgacgtgaccgttggccgcaacgtcaagatccag
aacaacgtcagcgtttatgacgcggtcaccttggaagatgacgtgttctgcgggccgagc
atggtctttaccaatgtctacaacccgcgctcggccgtcacgcgcaaggacgaatatcgc
cggacccttgtgaagcgcggcgccaccctcggcgccaattgcaccatcgtctgcggcaat
accgtgggcgaatacgcctttgtcggtgcaggcgccgtgatcaacagaaacgtaccggcc
tacgcgctcatggtcggagtgccggcaaaacagatcggctggatgagcgagtttggcgag
caactcgcactaccactgcagggcagggcagaagcggtttgtgaacacaccggagcgcgc
tacgtgctcgacggtaacgccgtaaccaagctggaagccaagacgccatga

DBGET integrated database retrieval system