KEGG   Variovorax paradoxus S110: Vapar_2344Help
Entry
Vapar_2344        CDS       T00916                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00010  Glycolysis / Gluconeogenesis
vap00053  Ascorbate and aldarate metabolism
vap00071  Fatty acid degradation
vap00280  Valine, leucine and isoleucine degradation
vap00310  Lysine degradation
vap00330  Arginine and proline metabolism
vap00340  Histidine metabolism
vap00380  Tryptophan metabolism
vap00410  beta-Alanine metabolism
vap00561  Glycerolipid metabolism
vap00620  Pyruvate metabolism
vap00625  Chloroalkane and chloroalkene degradation
vap00903  Limonene and pinene degradation
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_2344
   00053 Ascorbate and aldarate metabolism
    Vapar_2344
   00620 Pyruvate metabolism
    Vapar_2344
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Vapar_2344
   00561 Glycerolipid metabolism
    Vapar_2344
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_2344
   00310 Lysine degradation
    Vapar_2344
   00330 Arginine and proline metabolism
    Vapar_2344
   00340 Histidine metabolism
    Vapar_2344
   00380 Tryptophan metabolism
    Vapar_2344
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Vapar_2344
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Vapar_2344
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Vapar_2344
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Vapar_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACS18971
UniProt: C5CYL2
Position
1:complement(2507892..2509325)
Genome map
AA seq 477 aa AA seqDB search
MQLNFIANADVPSSSGRTLQVLDPSDGQPFDEIQRSNAADIDSAVRAARDCFEGVWHKVS
AADRGRLLYKLSQKVAEHVDELALIEQRDCGKPVKQARADALALVRYFEFYAGACDKLHG
ETIPYQDGYSVFTWREPHGVTGHIIPWNYPMQIFGRSVGGALAAGNVCVVKPAEDACLSL
IRVAQLAAEVGFPAGALNIVTGYGHEVGDALARHEGIDHISFTGSPKIGTLIQQVAAERH
CPVTLELGGKSPQIIFADADLDAAIPVIINAIVQNAGQTCSAGSRVLIQRGIYEPLLERL
GRAFEALRVGPAAMDLDVGPLIRQTQQQRVWDFLSDAQVAGIPMVAHGIVVDEAPETGFY
QAPTLLRDVPVNHRLAQEEVFGPVLAAMQFADEDEAVALANATQFGLVAGVWTTDGARQF
RMAKRVRSGQVFINNYGAGGGVELPFGGVKSSGYGREKGFEALYGFTTLKTVAIKHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcaacttcatcgccaacgccgacgtcccgtcatcctccggccgcaccctgcag
gtgctcgacccctccgacggccagcctttcgacgaaatccagcgcagcaatgccgccgac
atcgattccgccgtgcgcgcggcgcgcgactgcttcgagggcgtctggcacaaggtgagc
gcggccgaccgcggccgcctgctctacaagctctcgcagaaggttgccgagcacgtcgac
gagctcgcgctcatcgagcagcgcgattgcggcaagccggtgaagcaggcccgcgccgac
gcactcgcgctggtgcgctatttcgagttctatgccggcgcctgcgacaagctgcacggc
gagaccattccctaccaggacggctacagcgtcttcacctggcgcgagccgcacggcgtc
accggccacatcattccgtggaactacccgatgcagatcttcgggcgcagcgtgggcggc
gcgctggcggccggcaacgtgtgcgtggtgaagccggccgaggatgcctgcctttccctc
attcgcgtggcgcagctggcggccgaggtcggctttccggccggcgcgctcaacatcgtg
acaggctacggccatgaagtgggcgacgcgctcgcgcggcacgaaggcatcgaccacatc
agcttcaccggcagcccgaagatcggcacgctgatccagcaggtggcggcggagcggcat
tgcccggtcacgctcgaactcggcggcaagagcccgcagatcatctttgccgacgccgac
ctcgacgcggccattccggtgatcatcaacgccatcgtgcagaacgccggccagacctgt
tcggccggctcgcgcgtgctgatccagcgcggcatctacgagccgctgctcgagcgcctc
ggccgtgccttcgaggccctgcgcgtcggccccgcggccatggacctggacgtcggcccg
ctgatccgccagacacagcagcagcgcgtgtgggatttcctgagcgacgcccaggtggcg
ggcatcccgatggtggcccacggcatcgtggtcgacgaggcgcccgaaaccggcttctac
caggcccccaccctgctgcgcgacgtgccggtgaaccaccgcctcgcccaggaagaggtg
ttcggcccggtgctcgccgcgatgcagttcgccgacgaggacgaagcggtggcgctcgcc
aacgccacgcagttcggccttgtggccggcgtctggacgaccgacggtgcgcgccagttc
cgcatggccaagcgggttcgcagcggccaggtgttcatcaacaactacggcgccggcggc
ggcgtggaactgccgttcggcggcgtcaagtcgtcgggctacggacgcgaaaagggcttc
gaagcgctctacggcttcaccacgctcaagacggtggccatcaagcacggctga

DBGET integrated database retrieval system