KEGG   Variovorax paradoxus S110: Vapar_2585Help
Entry
Vapar_2585        CDS       T00916                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00072  Synthesis and degradation of ketone bodies
vap00650  Butanoate metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Vapar_2585
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Vapar_2585
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Vapar_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 Methyltransf_12 NAD_binding_3 DUF1378
Motif
Other DBs
NCBI-ProteinID: ACS19211
UniProt: C5CKQ7
Position
1:complement(2727169..2727939)
Genome map
AA seq 256 aa AA seqDB search
MLKRKTALVTGSTSGIGLAIAKSLAQQGANIVLNGFGDAETPKSQIEALGVRAEYHGADM
SQPAQIEDMMKFAASRFGRVDILVNNAGIQHVAKVEDFPPERWDAIIAINLTSAFHTTRL
AIPAMREANWGRIINVASAHGLVASAQKSAYVAAKHGIVGFTKSVALETATTGITSNAIC
PGWVLTQLVQKQIDDRAAREGISATQAQNELLGEKQPSLQFTTVEQLGGLAVFLCSPAAD
QVRGVAWQMDGGWTAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacgcaaaaccgcgcttgtcacggggtccaccagcggcattggcttggccatt
gccaagtcgcttgcacaacaaggcgcaaacatcgtgctcaacggtttcggcgacgccgaa
acccccaagtcccagatcgaggcgctcggcgtgcgcgccgaataccacggcgccgacatg
agccagcccgctcagatcgaggacatgatgaagttcgccgcgtccagattcgggcgcgtc
gacatcctcgtgaacaacgccggcatccagcacgtggcaaaggtcgaggacttcccgccg
gaacgctgggacgccatcatcgccatcaacctcacgagcgcattccacacgacccggctc
gccatacccgcgatgcgcgaggccaactggggccgcatcatcaacgtggcatcggcccac
ggcctggtggcctcggcgcagaagtcggcctacgtggcggccaagcacggcatcgtgggc
ttcaccaagtcggtggcgctcgaaaccgcaaccaccggcatcacgagcaatgcaatctgc
ccaggctgggtgctgacgcagctggtgcaaaagcagatcgacgaccgcgcggcgcgcgaa
ggcatctcggccacgcaggcgcagaacgagctgctcggggaaaagcagccttcgctgcag
ttcaccacggtcgagcagctcggcggcctggcggtgttcctgtgctcgccggccgccgac
caggtgcgcggcgtcgcctggcagatggacggcggctggaccgctcaataa

DBGET integrated database retrieval system