KEGG   Variovorax paradoxus S110: Vapar_2653Help
Entry
Vapar_2653        CDS       T00916                                 

Definition
(GenBank) Exodeoxyribonuclease I
  KO
K01141  exodeoxyribonuclease I [EC:3.1.11.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Vapar_2653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vap03400]
    Vapar_2653
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     Vapar_2653
DNA repair and recombination proteins [BR:vap03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     Vapar_2653
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Vapar_2653
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Vapar_2653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_X-T_C RNase_T
Motif
Other DBs
NCBI-ProteinID: ACS19278
UniProt: C5CLM1
Position
1:2796549..2797988
Genome map
AA seq 479 aa AA seqDB search
MNHTFLWHDYETFGAVPRRDRPSQFAAIRTDAELNEIGEPLMIYCKPAPDYLPSPEACLI
TGITPQLCLERGIPEHAFAAQIEKAFSQPGTIGVGYNTIRFDDEVTRFLFWRNLIDPYAR
EWQNDCGRWDLLDVVRLTYALRPDGIEWPKKEDGKPSFKLEDLARANGLLHESAHDALSD
VRATIALARLIRERQPKLFEFAFGLHKKDRVASELGLPAMRETARPFLHVSGMFPVERGC
LGVMWPLASHPTNKNELIAWDLAHDPSELRDLDVETLRLRLFTRTADLPEGVVRLPVKGI
HLNKSPMVVGNLRTLAPAMAERWNVDLDAALRHAAIARDLPDMSAIWSQVYARPKEAVPD
VDEDLYGGFVGNGDRRRLNQLRALSPEELAKDRTGFDDGRLEEILFRYRARNWPELLSSE
EAERWEALRAARLFKGEGGARTIEMLFSEVDALSETADERGEEILGALYEYAEAIAPEA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacacctttctctggcacgactacgaaaccttcggcgccgtgccgcgccgcgac
cggccatcgcagttcgccgccatccgcaccgacgccgagctcaacgagatcggcgagccg
ctgatgatctattgcaagccggcgcccgactacctgcccagccccgaggcctgcctgatc
accggcatcacgccgcagctctgcctggagcgcggcattcccgagcacgccttcgccgcg
cagatcgagaaggccttctcgcagcccggcaccatcggcgtgggctacaacaccatccgc
ttcgacgacgaggtcacgcgcttcctgttctggcgcaacctgatcgacccgtacgcccgc
gaatggcagaacgactgcggccgctgggacctgctggacgtggtgcgcctgacctacgcg
ctgcggcccgacggcatcgagtggccgaagaaggaagacggcaagcccagcttcaagctc
gaggacctggcgcgcgccaacggcctgctgcacgagtccgcgcacgatgcgctgtccgac
gtgcgcgccaccatcgcgctggcgcggctcattcgcgagcgccagcccaagctcttcgaa
ttcgccttcggcctgcacaagaaggaccgcgtcgccagcgagctcggcctgccggccatg
cgcgagacggcgcggcctttcctgcacgtgtcgggcatgttcccggtcgagcgcggctgc
ctcggcgtgatgtggccgctcgcgagccatccgaccaacaagaacgaactgatcgcctgg
gacctggcccacgaccccagcgagctgcgcgacctcgacgtcgagaccctgcgcctgcgc
ctgttcacgcgcaccgccgacctgcccgaaggcgtggtccgcctgccggtcaagggcatc
cacctcaacaagtcgccgatggtggtcggcaacctgcgcacgctggcgcccgccatggcc
gagcgctggaacgtcgaccttgacgcggcgctgcgccacgcggccatcgcgcgcgacctg
cccgacatgagcgccatctggtcgcaggtgtacgcgcggcccaaggaggcggtgcccgat
gtcgatgaagacctctacggcggcttcgtcggcaacggcgaccggcgccgcctgaaccag
ctgcgcgcgctgtcgcccgaggagctcgccaaggatcgcaccggtttcgacgacgggcgg
ctcgaggaaatcctctttcgctaccgcgcgcgcaactggcccgagctgctcagctcggaa
gaggccgaacgctgggaggcgctgcgcgccgcgcggctcttcaagggcgagggcggggcg
cgcaccatcgagatgctgttcagcgaagtcgatgcgctgtccgaaaccgcggacgagcgg
ggcgaagagatcctgggcgcactctacgagtacgccgaggccatcgcgcccgaagcctga

DBGET integrated database retrieval system