KEGG   Variovorax paradoxus S110: Vapar_2655Help
Entry
Vapar_2655        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACS19280
UniProt: C5CLM3
Position
1:complement(2799354..2799806)
Genome map
AA seq 150 aa AA seqDB search
MAKTGAATLLAAALSLCAAGAHALGSDHGYDGFKTPDAVSWVQLCGAWGKDHQGTYRVIH
ASQDAQSFLYVQWMARDANGRLNAAHTAAISELDNDHAEIALTDLGCRATPRGIVVTARA
ASGHDDKLRRVTIEAGPAPGQYRYRAQRTR
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacaggcgctgcaaccttgctcgcggccgcgctgtcgctgtgcgccgccggc
gcgcacgcgctgggcagcgaccacggctacgacggcttcaagacacccgatgcggtcagc
tgggttcagctgtgcggcgcctggggcaaggaccaccagggcacgtaccgggtgatccat
gccagccaggacgcgcagtcctttctctacgtgcagtggatggcgcgcgatgccaacggc
cgcctgaacgccgcacacaccgcagccatctccgaactggacaacgaccacgcggaaatc
gccctgaccgacctcggctgccgcgccacgccgcgcggcatcgtggtgacggcgcgcgcc
gcctccggccacgacgacaagctgcgccgcgtgaccatcgaggcggggccggcgccgggg
cagtaccggtatcgggcgcagcgcacgcgctga

DBGET integrated database retrieval system