KEGG   Variovorax paradoxus S110: Vapar_2673Help
Entry
Vapar_2673        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACS19298
UniProt: C5CLP1
Position
1:2816836..2817450
Genome map
AA seq 204 aa AA seqDB search
MISGSKIRFDWLCRSLLLALAFCAAPAWAFDLPDLMVLLAKQKSGEARFTEQRFVHGLEG
PLDARGTLSFDAPDKLVRRTLSPRVETMAVEGNTLTLSRGGRNRTLTLDSMPELLGLVEA
MRGTLTGDGATLQRYFRSTVSGSAANWTLDLLPADSRLAAQVRSIRISGRAGEVLGLEME
FVGGDRSVMSITPERPGAAGRTTP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatttctggctcgaagattcggtttgactggctttgcaggagcctgctgctggcactg
gccttctgcgccgcgccggcgtgggccttcgacctgcccgacctgatggtgctgcttgcc
aagcagaagagcggcgaggcccgcttcaccgagcagcgtttcgtgcacggcctcgaaggc
ccgctcgatgcgcgcggcacgctgagcttcgatgcgcccgacaagctggtgcggcgcacc
ttgtcgccgcgcgtggaaaccatggcggtcgaaggcaacacgctgacgctctcgcgcggc
ggccgcaatcgcacgctgacgctcgacagcatgcccgagctgctcggcctggtcgaagcc
atgcgcggcacgctgaccggcgatggcgccacgctgcagcgctatttccgcagcacggtg
agcggttcggccgccaactggacgctcgacctcctgccggccgacagccggctcgcggcg
caggtgcgcagcatccgcatcagcggccgtgccggcgaggtgctgggccttgaaatggag
ttcgtcggcggcgaccgctcggtgatgagcatcacgcccgagcgcccgggtgccgctgga
cgcaccacgccgtga

DBGET integrated database retrieval system