KEGG   Variovorax paradoxus S110: Vapar_2674Help
Entry
Vapar_2674        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF MMPL
Motif
Other DBs
NCBI-ProteinID: ACS19299
UniProt: C5CLP2
Position
1:2817447..2819855
Genome map
AA seq 802 aa AA seqDB search
MKERETGERGPPGWQRRALVLLVWALVLLGGALQIARTQFSADLSAFLPKSPDARQQVLI
EQLQSGVASRTLMLGIEGGASAEQRAAVSRAVAKSMRESRLFDLIQNGDTGDWSEAGTWV
FAHRYQLSPGVRPEHFTAEGLRDAIYETLSMLGTPAGNAIKPLLDRDPTGETQRIAVELT
PASAPRSEDGVWMSRSAPRALMIVTTRAAGSDLDAQAQTIASVHAAFDAATRGMEEATRP
KLLLSGPPVFSVLSRDKIKTEAIHLAIVGGIVMGGLLLLAFASPRALVIAFLPVATGVVV
GTAAVSVVFGSVHGMTLGFGSTLIGETVDYAIYYLIQARGAAVAGTGWARWRDVHWPTVR
LGLLTSVCGFAALVFSGFPGLAQLGVFSIAGLVAAALATRYALPMLAPDGATGMGMRRYM
ARAAGVLVRGLPHLRWMLAGLGVAALVLVIWQGGHLWRADLGAMSPVPKSAQQLDEMLRA
DIGTGDGGTLVVVYGADEETALRNTEAATARLEALVDKGELGGFEAVTRVLPSIATQSAR
LASLPDGETLRSRLAEATQGSPLPASRLGPFLADVEAARKLAPVRRADLAGGPLGSVVNT
LMYQRPGGGWSTLVVLHPGAKFDARRLEAALAGVPEVQVVDVGRELAGLYQRYLHEAFVQ
VLLGALAVVVLLGIYLRSGRRLLAVCQPLLFAVVLTLGGMAVLQVPLGILHLVGLLLIVA
VGSNYALFFDQLRVAGRADEDTLASLMLANLTTVVSFGLIAISDIPALSSIGRVVAPGAL
LALLLSAAFARRVAPTPPAARG
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggagcgcgagaccggggagcgcggcccgccgggctggcagcgccgggcgctggtg
ctgctggtctgggcgctggtgctgctcggcggcgcgctgcagatcgcgcgcacgcagttc
agcgccgacctttccgccttcctgcccaagagccccgacgcgcggcagcaggtgctcatc
gagcagctgcaaagcggcgtggcctcgcgcacgctgatgctcggcatcgagggcggcgcg
agtgccgagcagcgcgcggccgtatcgcgcgccgtggccaagtccatgcgcgagagccgg
ctcttcgacctgatccagaacggcgacaccggcgactggagcgaggccggcacctgggtc
ttcgcgcaccgctaccagctttcgccgggcgtccggcccgagcatttcaccgccgaaggc
ctgcgcgacgcgatctacgaaacgctgtcgatgctcggcacgccggccggcaacgcgatc
aagcccttgctcgaccgcgatcccaccggcgagacccagcgcattgccgtcgagctgacg
ccggccagcgcgccgcgcagcgaagacggcgtctggatgtcgcgcagcgcgccgcgggcg
ctcatgatcgtcaccacgcgcgcggcgggcagcgatctcgacgcccaggcgcaaaccatt
gcaagcgtgcacgcggccttcgatgccgccacgcgcggcatggaagaggccacccggccg
aagctgctgctgagcggcccgcccgtgttctcggtgctgagccgcgacaagatcaagacc
gaagcgatccacctcgcgatcgtgggcggcatcgtgatgggcggcctgctgctgctggcc
ttcgcgtcgccgcgcgcgctggtcatcgcgttcctgcccgtggccaccggcgtggtggtg
gggaccgcggcggtcagcgtggtgttcggctcggtgcacggcatgacgctgggcttcggc
agcacgctgatcggcgagaccgtcgactacgccatctactacctgatccaggcgcgcggc
gcggccgtggccggcaccggctgggcgcgctggcgcgatgtgcactggcccaccgtgcgg
ctcgggctgctgacctcggtgtgcggcttcgcggcgctggtgttctcgggattcccgggc
ctggcgcagctgggcgtgttctccatcgcagggctcgtggccgcggcgctggccacgcgc
tacgcattgcccatgctcgcgcccgatggcgccaccggcatgggcatgcgccgctacatg
gcgcgcgcggccggcgtgctcgtgcgcggcctgccgcacctgcgctggatgcttgcgggg
ctcggcgtggctgcgctggtgctggtcatctggcagggcggccatctgtggcgcgccgac
ctcggcgccatgagcccggtgcccaagtcggcccagcagctcgacgagatgctgcgcgcc
gacatcggcaccggcgacggcggcacgctggtggtggtgtacggcgccgatgaagaaacc
gcactgcgcaacaccgaagccgccaccgcgcggctcgaagccctggtcgacaagggcgag
ctcggcggcttcgaggccgtgacgcgcgtgctgccgagcatcgcgacgcagtcggcccgg
ctcgcgagcctgcccgacggcgagacgctgcgcagccggctggccgaagccacccaaggc
tcgccgctgccggcctcgcgcctcggccctttcctggccgatgtcgaagccgcgcgcaag
ctcgcgcccgtgcggcgcgccgacctggcgggcgggccgctcggctcggtcgtcaacacg
ctcatgtaccagcgcccgggcggcggctggtcgacgctggtggtgctgcaccccggggca
aagttcgacgcgcgccggctcgaagcggcgctggcgggcgtgcccgaggtgcaggtggtc
gacgtgggccgcgaactcgcggggctctatcagcgctacctgcacgaggccttcgtgcag
gtgctgctcggcgcgctggcggtggtggtgctgttgggcatctacctgcgctcgggccgg
cggctgctcgcggtgtgccagccgctgctgttcgcggtggtgctcacgctgggcggcatg
gccgtgctccaggtgccgctgggcatcctgcacctggtggggctgctgctgatcgtggcg
gtgggctccaactacgcgttgttcttcgaccagctgcgcgtggccgggcgggccgacgag
gacacgctggcgtcgctgatgctggccaacctcaccacggtggtgtctttcgggctgatc
gcgatctcggacattccggcgctgtcgtcgatcggccgcgtggtggcgccgggcgccttg
ctggcgctgctgctgtcggccgcgtttgcgcgccgcgtggcgcccacgccgcccgccgcg
cgcggctga

DBGET integrated database retrieval system