KEGG   Variovorax paradoxus S110: Vapar_2676Help
Entry
Vapar_2676        CDS       T00916                                 

Definition
(GenBank) Methyltransferase type 11
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_31 Methyltransf_2 MTS CheR Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ACS19301
UniProt: C5CLP4
Position
1:2820694..2821476
Genome map
AA seq 260 aa AA seqDB search
MSAVLPSSSSSSSSTDAAWRELHEAATVPYKKGGSFAWHFARGKLGRDPVFRGLLERGLI
DAAHRRVVDIGCGQGLFASLLASMSRMQAHGRWPSSWKPTPPAADYTGIELMPKDVARAE
ASIGHLQPAPRLVCADMCSVPLPECDLVVILDVLHYVGIDAQDGVLRRVHDALRRGGSAN
ARLLLRVGDASSKRGFAISQWVDRTVTRVRGHKVSPTWGRPLSDWVAALQRLDFRVQSIP
MSKGTPFANVLLVADLEHRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtgctgccttcttcgtcgtcgtcgtcttcttccaccgatgccgcctggcgc
gagctgcatgaggccgccaccgttccctacaagaagggcggcagcttcgcctggcatttc
gcgcgcggcaagctggggcgcgatccggtgttccgcgggctgctcgaacgcgggctgatc
gatgcagctcaccggcgcgtggtcgacatcggctgcgggcaggggctcttcgcgagcctg
ctcgcgtcgatgagccgcatgcaggcgcacggccgctggccctcgtcgtggaagcccacg
ccgccggccgccgactacacgggcatcgagctgatgcccaaggacgtggcgcgcgccgag
gcttccatcgggcacctgcagccggcgccgcggctggtctgcgccgacatgtgctcggtg
ccgctgcccgaatgcgacctggtcgtgatcctcgacgtgctgcactacgtgggcatcgac
gcgcaggacggcgtcctgcggcgggtgcacgacgcgcttcggcgcggcggcagtgcgaac
gcccggctgctgctgcgcgtgggcgatgcatcgagcaagcgcggctttgccatcagccag
tgggtcgaccgcaccgtgacgcgcgtccgaggccacaaggtgtcgcccacctggggccgt
ccgctgtccgactgggtggcggcgctgcagcggctggactttcgcgtccagagcattccg
atgagcaagggaacgccctttgccaacgtgctgctggtggccgacctggagcatcgggcg
tga

DBGET integrated database retrieval system