KEGG   Variovorax paradoxus S110: Vapar_2678Help
Entry
Vapar_2678        CDS       T00916                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00061  Fatty acid biosynthesis
vap00780  Biotin metabolism
vap01040  Biosynthesis of unsaturated fatty acids
vap01100  Metabolic pathways
vap01130  Biosynthesis of antibiotics
vap01212  Fatty acid metabolism
Module
vap_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Vapar_2678
   01040 Biosynthesis of unsaturated fatty acids
    Vapar_2678
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Vapar_2678
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Vapar_2678
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vap01004]
    Vapar_2678
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Vapar_2678
Lipid biosynthesis proteins [BR:vap01004]
 Fatty acid synthase
  Component type
   Vapar_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C NAD_binding_4 RmlD_sub_bind F420_oxidored GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ACS19303
UniProt: C5CLP6
Position
1:2821943..2822674
Genome map
AA seq 243 aa AA seqDB search
MTLEGKRALITGASGALGAAMAERLARDGATVLLHANSRPEAVEQLAATIAAAGGKAECH
LFDLRSDEACRVACERMLEGGPVQIVVNNAGVHDDAVLPGMRADQWHKVIDISLNGFFRV
TQPLLLPMMRTRWGRVLNISSVSALTGNRGQVNYAAAKGALNSATKALSLEVASRGVTVN
AIAPGIIASPMADAAFDPAMVNQMVPMKRAGTPQEVAALASFLASDEAAYITGQVISING
GMI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgaaggaaaacgcgcactcatcaccggcgccagcggtgccctgggcgctgcc
atggccgagcgcctcgcgcgcgacggcgccacggtgctgctgcacgccaactcgcggccc
gaagcggtggagcaattggcagccaccatcgcggccgcgggcggcaaggccgagtgccac
ctgttcgacctgcgcagcgacgaggcctgccgcgtggcctgcgagcgcatgctcgaaggc
gggccggtccagatcgtggtcaacaacgcgggcgtgcatgacgacgccgtgctgcccggc
atgcgtgccgaccagtggcacaaggtcatcgacatctcgctcaacggattcttccgcgtg
acgcagcccttgctgctgccgatgatgcgcacgcgctggggccgcgtgctcaatatctcg
tcggtctcggcgctgaccggcaaccgcgggcaggtcaactacgccgccgccaagggtgcg
ctcaacagcgcgaccaaggcgctgtcgctcgaagtggcctcgcgcggcgtgacggtcaac
gccattgcgcccggcatcatcgcctcgcccatggccgatgccgccttcgaccccgccatg
gtcaaccagatggtgccgatgaagcgcgccggaacgccgcaggaagtggcggcgctggct
tcattcctcgccagtgacgaagcggcctacatcacggggcaggtgatttcgatcaatggc
ggaatgatctga

DBGET integrated database retrieval system