KEGG   Variovorax paradoxus S110: Vapar_2680Help
Entry
Vapar_2680        CDS       T00916                                 

Definition
(GenBank) phospholipid/glycerol acyltransferase
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: ACS19305
UniProt: C5CLP8
Position
1:complement(2823883..2824686)
Genome map
AA seq 267 aa AA seqDB search
MSMTRVLRILTAIPLALMLYALLLFLGLISLAWNLVAMLLYPVMPEAPARTLGRLTIAFA
YRMFWGLASVTGMMRIDASCLDPMRNEPGVIFVANHPTMLDALLLVARLPRSACIMKADL
LRNIFLGAGARLARYISNESARTMVRLAVADLRNGGQLVIFPEGTRTVTPPLNPFGPGVT
LIAKLAQAPIQTVFIETDSPYLSKGWPLWRVPPLPIVFRLRLGQRFAPMQDSHVLQSELE
QYFRQHMEQRATDASPACQTPRAHTLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgacccgcgtgctgcgcattctcacggccattccgcttgcgttgatgctctac
gcgctgctgctgttcctggggctgatttcgctggcctggaacctcgtcgcgatgctgctc
tacccggtgatgcccgaggcgcccgcgcgcacgctgggccgcctgaccatcgccttcgcc
taccgcatgttctggggcctggcctcggtgaccgggatgatgcgaatcgacgccagctgc
ctggacccgatgcgcaacgagccgggcgtgatcttcgtggccaaccaccccaccatgctc
gacgcgctgctgctggtggcgcggctgccgcgcagcgcctgcatcatgaaggccgacctg
ctgcgcaacatcttcctgggcgcgggcgcacggctggcgcgctacatcagcaacgagtcg
gcccgcaccatggtgcgcctggcggtggccgacctgcgcaatggcggccagctggtgatc
tttccggaaggcacgcgcaccgtgacgccgccgctcaatcccttcggccccggcgtgacg
ctgatcgccaagctcgcgcaggccccgatccagaccgtgttcatcgagaccgactcgccc
tacctcagcaagggctggccgctgtggcgcgtgccgccgctgcccatcgtcttcaggctc
cggctgggccagcgcttcgcgcccatgcaggacagccacgtgctgcaatcggagctcgaa
caatactttcgccaacacatggaacagcgcgcaaccgacgcgtcccccgcatgccagacg
cctcgcgcacacaccttgtcctga

DBGET integrated database retrieval system