KEGG   Variovorax paradoxus S110: Vapar_2691Help
Entry
Vapar_2691        CDS       T00916                                 

Definition
(GenBank) lipid A ABC exporter, fused ATPase and inner membrane subunits MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
vap  Variovorax paradoxus S110
Pathway
vap02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Vapar_2691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vap02000]
    Vapar_2691
Enzymes [BR:vap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Vapar_2691
Transporters [BR:vap02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Vapar_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 DUF2721 AAA_30 RsgA_GTPase AAA_29 AAA AAA_22 AAA_33 SRP54 AAA_5 AAA_25 AAA_24 AAA_23 AAA_28 MobB U71 AAA_18 DUF87
Motif
Other DBs
NCBI-ProteinID: ACS19316
UniProt: C5CLQ9
Position
1:complement(2833535..2835256)
Genome map
AA seq 573 aa AA seqDB search
MTWFGGSRHWWAVGLIGALLAAVTEPLMAALLKPLLDRGFNRGQLALWIVPAAVLLLFAV
RGIAQFISQYALSRIANEGMQRLRRVLFQRLLAAELALFSRQSASALSNTVVYEVQTGSM
LLVQALLGLSRDGFTLVALLAYLVYLNWKLTLIVAFLVPSISWIMKVFSKRLYRLTQQGQ
QATDELAYVVEENVLAHRMVRLHGAEAAQGERFEQLSQRLNRLAVKSTIAQAATTPLTQM
MAALALSVVVMIALWQSGEQGLTVGGFVAYITAMLMLIAPIRRLADMAAPITRGLAALER
GLVLIDEVAPEPQGSFAIDHAQGRIELREARVSYRGEDEARALDGVNLMIEPGQVVAFVG
PSGSGKTTLVNLLPRFVLPSGGQVLLDGHDTSEWELKSLRAQFAMVSQDVVMLNDTLAAN
VALGAAVDRARVQQCIEAANLASHVESLPQGIDTVLGHNATQLSGGQRQRLAIARALYKN
APILLLDEATSALDTESERLVQDALQRLMQNRTTLIVAHRLSTIQHADRIIVMEQGRIAE
QGSHAQLMALDGLYARLQTLAVRSATPGQDPTL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacctggttcggcggctcgcgccactggtgggccgtcgggctcatcggcgccctgctg
gcggccgtcaccgagcccttgatggcggccctgctgaagccgctgctcgaccgcggcttc
aaccgcggccagctcgcgctgtggatcgtgccggcggccgtgctgctgctgttcgcggtg
cgtggcatcgcgcagttcatttcccaatatgcgctctcgcgcatcgccaacgaaggcatg
cagcggctgcgccgcgtgctgttccagcgcctgctggcggccgagctggcgctgttctcg
cgccagtcggccagcgcgctttccaacaccgtggtgtacgaggtgcagaccggctccatg
ctgctggtgcaggccctgctcgggctctcgcgcgacggcttcacgctggtggcgctgctc
gcctacctggtctatctgaactggaagctcacgctcatcgtcgccttcctggtgccgagc
atctcgtggatcatgaaggtgttctccaagcgcctgtaccgcctgacccagcagggccag
caggccaccgacgaactcgcctatgtggtggaagagaacgtgctcgcgcaccgcatggtg
cggctgcacggggccgaggcggcgcagggcgagcgcttcgaacagctgagccagcgcctg
aaccgcctggccgtgaaatcgaccattgcgcaggccgccaccacgccgctcacgcagatg
atggccgcgcttgcactgtcggtggtggtgatgatcgcgctctggcagagcggcgaacag
ggcctgaccgtgggcggcttcgttgcctacatcacggccatgctgatgctgatcgcgccg
atccgccggctggcggacatggccgcgcccatcacgcgcggccttgcagcgctcgaacgc
ggcctggtgctgatcgacgaagtggcgccagagccgcagggcagcttcgccatcgaccat
gcgcaaggccgcatcgaactgcgcgaggccagggtcagctaccgcggcgaggacgaggcc
cgcgcgctcgacggcgtgaacctgatgatcgagccgggtcaggtggtggccttcgtcggg
ccttcgggatccggcaagaccacgctggtcaacctgctgccgcgcttcgtgctgccgagc
ggcggccaggtgctgctcgacgggcacgacaccagcgaatgggagctcaagagcctgcgc
gcgcagttcgcgatggtgagccaggacgtggtgatgctcaacgacacgctggccgccaac
gtggcgctgggcgccgccgtcgatcgcgctcgcgtgcagcagtgcatagaagccgccaac
ctcgcctcccacgtcgaaagcctgccgcagggcatcgacacggtgctcggccacaacgcc
acgcagctttccggcggccagcgccagcgcctggccattgcacgcgcgctctacaagaac
gcgcccatcctgctgctcgacgaggccacctcggccctcgacaccgaatcggaacggctg
gtgcaggacgccctgcagcgcctgatgcagaaccgcaccacgctgatcgtcgcccaccgg
ctctcgaccatccagcatgccgaccgcatcatcgtgatggagcagggccgcatcgccgag
caaggcagccacgcgcagctgatggcgctggacggcctctatgcccggctgcagacgctg
gcggtgcgcagcgcgacgccgggccaggacccgacgctctga

DBGET integrated database retrieval system