KEGG   Variovorax paradoxus S110: Vapar_2692Help
Entry
Vapar_2692        CDS       T00916                                 

Definition
(GenBank) Tol-Pal system beta propeller repeat protein TolB
  KO
K03641  TolB protein
Organism
vap  Variovorax paradoxus S110
Brite
Transporters [BR:vap02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Vapar_2692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PD40 TolB_N DPPIV_N Gmad1 DUF5050
Motif
Other DBs
NCBI-ProteinID: ACS19317
UniProt: C5CLR0
Position
1:2835571..2836797
Genome map
AA seq 408 aa AA seqDB search
MLPALAQFRVEVSGVGLTQLPIALVPFKGQDASPQKISEIVQADLERSGQFRGVDASGQA
LDEASRPDLALWRQRTADSLVVGSVTRLADGRFDVRFRLWDVVRGQDLGGQSYTVPQGDL
RLASHRIADYVYEKLTGDKGIFSTRIAYVTKGGSRYSLWVADADGENAQAALASPEPIIS
PVWSSNGQQLAYVSFESRKPVVYVHNVASGQRRLLANFRGSNSAPAWAPDGGSLAVTLSR
DGGSQLYTIPASGGEPRRLTQSASIDTEPVYSADGSTIYFVSDRGGAPQIYKMSASGGAP
TRVTFSGTYNISPSVSGDGRWLAYISRVGGAFKLHVMELATGNVSAITDTSADESPSFAP
NSKLIVYATHLQGREALMTTTLDGKIKARLAGQGGDIREPDWGPFQKQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgcgctcgcccagttccgggtcgaggtgtcgggcgtcggactcacgcagctg
cccattgcgctggttcccttcaaggggcaggacgcctcgccgcagaagatctccgagatc
gtgcaggccgacctggagcgcagcggccagttccgcggcgtcgatgcctcgggccaggcg
ctggacgaagcctcgcgccccgacctcgcgctgtggcgccagcgcacggccgattcgctc
gtggtgggcagcgtcacgcgcctggccgacggccgcttcgacgtgcgcttccgcctgtgg
gacgtggtgcgcggacaggacctcggcggccagagctacaccgtgccgcaaggcgatctt
cggctcgcctcgcaccgcattgccgactacgtctatgaaaagctgaccggcgacaagggc
atcttctcgacccgcatcgcctacgtgaccaagggcggcagccgctattcgctgtgggtg
gcggatgccgacggcgagaacgcgcaggccgcgctcgccagccccgaacccatcatctcg
ccggtctggtcgtccaacgggcaacagctggcgtacgtgtccttcgagtcgcgcaagccg
gtggtgtacgtgcacaacgtggcgagcgggcagcgccgcctcttggccaacttccgcggt
tccaacagcgcgccggcatgggcgcccgatggcggctcgctggccgtcacgctcagccgc
gacggcggctcccagctctacacgatcccggcgagcggcggcgagccgcgccgcctgacc
cagagcgccagcatcgacaccgagcccgtctactcggccgacggcagcacgatctacttc
gtgagcgaccgaggcggtgcgccgcagatctacaagatgagcgccagcggcggcgcgccg
acgcgcgtcaccttcagcggcacctacaacatttctccttctgtcagcggcgatggccgg
tggttggcctacatctcccgcgttggcggcgccttcaaactccatgtgatggagttggcc
accggcaatgtctcggccatcaccgacacctcggcagacgagagcccgagttttgccccc
aacagcaagctgatcgtctacgcaacgcacctgcaaggccgcgaagcgctcatgacgacc
acgctggatggaaaaataaaggcacgtctggcgggacagggcggagacataagagaaccg
gactggggtccgtttcaaaagcaatga

DBGET integrated database retrieval system