KEGG   Variovorax paradoxus S110: Vapar_2693Help
Entry
Vapar_2693        CDS       T00916                                 

Definition
(GenBank) peptidoglycan-associated lipoprotein
  KO
K03640  peptidoglycan-associated lipoprotein
Organism
vap  Variovorax paradoxus S110
Brite
Transporters [BR:vap02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Vapar_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA
Motif
Other DBs
NCBI-ProteinID: ACS19318
UniProt: C5CLR1
Position
1:2836823..2837341
Genome map
AA seq 172 aa AA seqDB search
MLKRTIYSLAIVALIAGCSSGTKLNDTPVTDRSGTAGGQQGSASAVAPVTIDPNAGTAQG
PVGIERIVYFDYDSYTVKPEFQSLIDGHARFLKANPQRRVSIEGHTDDRGGREYNLALGQ
KRSEAVRRALTLLGVSDAQIEAVSFGKEKPAVQGSGEEAWAQNRRAEIRYTR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgtacgatttattcgctggccatcgtggctctgattgccggctgctcgtcg
ggcaccaagctcaacgacaccccggtgaccgaccgctccggcaccgccggcggccagcag
ggcagcgcgagcgccgtggcgcccgtcaccatcgatcccaatgccggtaccgctcaaggg
ccggtcggtatcgaacggatcgtctatttcgactacgacagctatacggtcaagcccgag
ttccagtccctgatcgacggccacgcccgtttcctcaaggccaacccgcagcgccgcgtt
tccatcgaaggccacaccgacgaccgtggcggccgcgagtacaaccttgcactcggccag
aagcgctccgaggccgtccgccgcgcgctgacgctcttgggcgtgagcgacgcccagatc
gaagccgtgagcttcggcaaggaaaagcccgcggtccagggctcgggcgaagaagcctgg
gcacagaaccgccgcgctgaaatccgctacacccggtga

DBGET integrated database retrieval system