KEGG   Variovorax paradoxus S110: Vapar_2698Help
Entry
Vapar_2698        CDS       T00916                                 

Definition
(GenBank) hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACS19322
UniProt: C5CLR5
Position
1:complement(2840819..2841199)
Genome map
AA seq 126 aa AA seqDB search
MNATQPMQPTAPLSMTAKFFWDHAEWFTLLDGDSAKSRTKSALRLAEAEAQYLNAESLAG
YTFKVRANRKSNRPRTWTMWIAQADGQPVAWLDDVADNGPVNRRVVRAELALDAAETLKP
ALAAAR
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacccaaccgatgcagccaaccgcccccctcagcatgaccgccaaattcttc
tgggaccacgccgaatggttcaccctcctcgacggcgactcggcgaagtcccgcaccaag
agcgcactccgtcttgctgaggctgaagcgcagtaccttaacgccgaaagtctcgcaggc
tatacgttcaaagtccgcgccaatcgcaagagcaaccggccgcgcacatggaccatgtgg
atcgcacaggcagacgggcagcccgttgcgtggctagacgacgtggccgacaacggcccc
gtcaaccgccgtgttgtccgcgccgaactggcgcttgatgcagcggaaacgctgaaaccc
gcattggccgccgcccgctga

DBGET integrated database retrieval system