KEGG   Variovorax paradoxus S110: Vapar_2699Help
Entry
Vapar_2699        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACS19323
UniProt: C5CLR6
Position
1:2841407..2842201
Genome map
AA seq 264 aa AA seqDB search
MSEVSSRVLAWLDTGGFPLEMKAAAAFRHAGFEVRQSATYADPVTEKGREIDVLANDPDL
FGFVDLATVIECKSSPNPWVVLTAKDAMEGYNCLRTRAVFSDRAYLGLTRDAVNSLQVSP
LLHAAGRCGYALRQAFSKGNDPGYEAAMAVVSACKGVFPSLAGTGAATVAAAIPIIVVNA
PIFECELGLDGKLRLTEVLQSDFIFSARIPKNVSCTIRVVHIDAVDDTARWAKQIVDRLR
ADLRPEEQRVLAELSKPKVGSSPA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggtttcttcccgggtcctcgcgtggcttgacacagggggattccccttggag
atgaaggccgccgcagccttccgccatgccggcttcgaagtgcggcaatccgctacctat
gccgatcccgtgacggagaaggggcgcgagattgacgtattggcgaacgatccagacctc
ttcgggttcgtggacctcgcaacagttatcgaatgcaaatcgtcaccaaacccctgggtg
gtgctgaccgcgaaggacgcgatggaggggtacaactgtctccgaactcgagcagtgttt
tcggatcgcgcctacttggggctgacccgagacgctgtgaatagtctccaagtaagcccg
ctgctgcacgcggcgggcagatgcgggtacgcgttacggcaagccttttcgaaagggaac
gaccctgggtacgaggccgcaatggctgtcgtctctgcatgcaagggggtttttccgtct
ttggcggggactggcgccgccactgtcgcagcggctataccgatcatcgtggtgaatgcc
cccatctttgaatgtgagctgggccttgacgggaaactgcgactcacagaggtgctccag
tccgatttcatcttctccgcacgaatccccaaaaatgtcagctgtaccatccgcgtcgtg
cacatcgatgcggttgacgacacggccaggtgggccaagcagatcgtggaccggctgcgg
gccgacttgcggccggaagagcagcgcgtcctggcggagctgtcgaagccgaaggtagga
tcaagccctgcctga

DBGET integrated database retrieval system