KEGG   Variovorax paradoxus S110: Vapar_2723Help
Entry
Vapar_2723        CDS       T00916                                 

Definition
(GenBank) ATP-dependent helicase HrpA
  KO
K03578  ATP-dependent helicase HrpA [EC:3.6.4.13]
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Vapar_2723
Enzymes [BR:vap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Vapar_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3418 HA2 OB_NTP_bind Helicase_C DEAD AAA_22 NACHT AAA_19 T2SSE AAA_30 AAA_23 SRP54 Mei4 AAA_25 PhoH FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ACS19345
UniProt: C5CLT8
Position
1:2868687..2872556
Genome map
AA seq 1289 aa AA seqDB search
MTTTTPSAPLRIDFPESLPVSGRRDEIMAAIAAHQVVIVCGETGSGKTTQLPKIALALGR
GKLNAPPGQGRLIGHTQPRRIAASSVAKRIAEELKTPLGDVVGFKVRFQDRLSRDASVKL
MTDGILLAETQTDPLLKAYDTLIIDEAHERSLNIDFLLGYLREILPRRPDLKVIVTSATI
DAERFAQHFASAKGPAPTIMVSGRTFPVEQRYRPFEESREHDLNDAIADGVDELWRDPHN
AGDILVFLPGEREIREAADHLRRHLSHQPLLRNAEVLPLFARLSGPEQDRIFDSHSGRRI
VLATNVAETSLTVPGIRYVIDTGTARVKRYSFRSKVEQLLVEPISQAAANQRAGRCGRVA
NGICIRLYDEKDFEGRPRFTDPEILRSSLAGVILRMKSLRLGDVARFPFLEAPSPRAIAD
GYQLLNELGAVDDANELTATGAELARLPLDPRVGRMILEARTRGALEEVLVIASALSVQD
VRDRPMDAQQQADQAHSKFDDEKSEFSGYLRLWKWIADARGGHGDTHKLSNRQYEQLLRQ
NFINIRRVREWRDIHSQLLTVVTEHKWRINAEPAGYEPLHLSMLAGLLGNVGWKLEDDEA
YLGARGIKFYKHPGAHLKKKPGRWIVAAELVETTRLFGRGIANIEPQWLEQVAGHLLKKQ
LLDPHWEKKGAQVSALERATLYGLVVYSGRRVDFTKVDPVAAREIFIREALVGGQWESKF
PFLAANRKLVREVEGLEHKARRQDVLVDDELIFAFYDAQLPADVASGISFENWYRHASRE
QPRLLFLTREELMRHQAAGITTQSFPPTLRLGGVDCAASYLHAPGDAKDGLTVSVPLFVL
NQVSEERCEWLVTGMLKDKIQALLKSLPQRPRSRLVPLPESAARLAEELSAPEVFGHGSL
TDVLLKRVRDTTSIDVKRADFKLDMLPPHLFMNLRIVDEHGRQLGMGRNLGALKAELGAQ
ARGAFQALAGLNVKASADRKPADAAEGHGQAKGNAAAPAPAAPSLPAGQRYTNWSFGELP
ELMEVRRGSQSLIGFPALRDEGDAVTIEVFDEPAVAAAKHRAGLRRLFALQLKDALKYLE
KNIPDLQKMAVAYMPLGTSEELRAQIIDVAIDRAFLQEPLPTDEFAFKRRLEEGRGRLTL
IANEVARLASAILAEYAAAARKIKDTKLQPEAVQDAAQQLQRLVGKRFIADAPWTQLQHF
ARYLKAIVLRLDKLRSDPARDAAKLAELRPQEQRYWRLVAERKGVVDERMLEFRWLLEEL
RVSFFAQELRTPQPVSIKRLDKAWAQLQA
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaccacgacaccttccgcccccttgcgcatcgactttcccgaatcgcttccggtc
tccggccggcgcgatgaaatcatggccgccatcgcggcgcaccaggtggtgatcgtctgc
ggcgaaacgggctcgggcaagaccacccagttgccgaagatcgcgctggcgctcggccgc
ggcaagctcaatgcgccgccgggccagggccggctcatcggccacacgcagccgcggcgc
attgccgccagctcggtggccaagcgcatcgccgaagagctgaagacgccgctgggcgac
gtggtcggcttcaaggtgcgcttccaggaccggctgagccgcgacgcgtcggtcaagctc
atgaccgacggcatcctgctggccgagacgcagaccgatccgctgctcaaggcctacgac
acgctgatcatcgacgaggcgcacgagcgctcgctcaacatcgacttcctgctcggctac
ctgcgcgagatccttccgcgccggcccgacctgaaggtgatcgtgacctcggccaccatc
gacgccgaacgcttcgcgcagcatttcgcctcggcaaaaggcccggcgccgacgatcatg
gtgtccgggcgcaccttcccggtcgagcagcgctaccggcccttcgaggagtcgcgcgag
cacgacctgaacgacgccattgccgacggcgtcgacgagctctggcgcgatccgcacaac
gccggcgacatcctggtcttcctgcccggcgagcgcgagatccgcgaggccgccgaccac
ctgcgccgccacctgagccaccagccgctgctgcgcaacgccgaggtgctgccgctgttc
gcgcggctgtcgggccccgagcaggaccgcatcttcgacagccattcgggccggcgcatc
gtgctggccaccaacgtggcggaaacctcgctcaccgtgccgggaatccgctacgtgatc
gacaccggcacggcgcgcgtgaagcgctacagcttccgcagcaaggtcgagcagctgctg
gtcgagccgatcagccaggcagcggccaaccagcgcgccggccgctgcggccgcgtggcc
aacggcatctgcatccggctctacgacgagaaggatttcgaaggccggccgcgcttcacc
gacccggaaatcctgcgctcgtctctcgcgggcgtgatcctgcgcatgaagtcgctgcgg
ctgggcgacgtggcgcgctttccgtttctcgaggcgccctcgccgcgcgcgattgccgac
ggctaccagctgctcaacgagctcggcgcggtcgacgacgccaacgaactcacggccacg
ggcgccgagctcgccaggctgccgctcgatccgcgcgtgggccggatgattcttgaagcc
cgcacgcgcggcgcgctcgaagaggtgctggtcatcgcgtcggcgctcagcgtgcaggac
gtgcgcgaccggccgatggacgcgcagcagcaggccgaccaggcgcattccaagttcgac
gacgagaagagcgagttcagcggctacctgcggctgtggaaatggatcgccgatgcgcgc
ggcggccatggagacacccacaagctcagcaacaggcagtacgagcagctgctgcgccag
aacttcatcaacatccgccgcgtgcgcgaatggcgcgacatccattcgcagctgctcacg
gtggtcaccgagcacaagtggcgcatcaacgccgagccggccggctacgagccgctgcac
ctgtcgatgctcgcgggcctgcttggcaacgtcggctggaagctggaagacgacgaggcc
tacctgggtgcgcgcggcatcaagttctacaagcatccgggcgcgcacctgaagaagaag
cccggccgctggatcgtcgcggccgagctggtcgagaccacgcggctcttcggccgcggc
attgccaacatcgagccgcagtggctcgaacaggtggccggccacctgctgaagaagcag
ctgctcgatccgcattgggagaagaagggcgcgcaggtttcggcgctggagcgcgcaacg
ctctacggcctcgtggtgtacagcgggcgccgcgtcgacttcacgaaggtggacccggtg
gcggcgcgcgagatcttcatccgcgaagcgctggtcggcgggcagtgggagagcaagttt
ccgttcctcgcggccaaccgcaagctggtgcgcgaggtcgaagggctggagcacaaggcg
cgccggcaggacgtgctggtcgacgacgagctgatcttcgccttctacgacgcgcagctg
cccgccgacgtggccagcggcatcagcttcgagaactggtaccgccatgcctccagggag
cagccgcgcctgctcttcctcacgcgcgaggaactgatgcgccaccaggccgcgggcatc
accacgcagtcctttccgcccacgctgcggctgggcggcgtcgactgcgcggcaagctac
ctgcacgcgcctggcgacgccaaggacggcctcacggtcagcgtgccgctcttcgtgctc
aaccaggtgagcgaagagcgctgcgaatggttggtgaccggcatgctcaaggacaagatc
caggcgctgctcaagagcctgccgcagcggccgcgctcgcggctggtgccgctgcccgag
tcggccgccaggctggcggaagagctttcggcgcccgaagtgttcggccacggctcgctg
accgatgtgctgctcaagcgcgtgcgcgacaccacgagcatcgacgtcaagcgtgccgac
ttcaagctcgacatgctgccgccgcatctgttcatgaacctgcgcatcgtggacgagcac
ggtcgccagcttggcatggggcgcaacctgggtgcgctcaaggcggagctgggcgcgcag
gcgcgcggcgcttttcaggcgctggccggcctcaacgtcaaggcgtcggcggaccgcaag
ccggccgacgcagccgagggacacgggcaggccaagggcaacgccgctgcgccggcaccc
gccgcgcccagcctgcctgccggccagcgctacaccaactggagcttcggcgaactgccc
gagctgatggaagtgcggcgcggatcgcagtcgctgatcggatttccggcgctgcgcgac
gagggcgatgccgtcaccatcgaggtgttcgacgagcccgccgtggcggccgccaagcac
cgcgccgggctgcgccgcctgttcgcgctgcagctgaaggatgcgctcaagtacctcgag
aagaacatccccgacctgcagaagatggccgtggcctacatgccgctgggtacctcggag
gagctgcgcgcgcagatcatcgacgtggcgatcgaccgggccttcctgcaggagccgctg
ccgaccgacgagttcgccttcaagcgccgcctcgaagagggccgcggccggctcacgctg
atcgccaacgaggtggcgcggctggcctcggccatcctggccgagtacgcggccgccgcg
cgcaagatcaaggacaccaagctccagcccgaggccgtgcaggacgccgcgcagcagctg
cagcgcctggtcggcaagcgcttcatcgcggacgcgccgtggacgcagctgcagcatttc
gcgcgctatctcaaggccatcgtgctgcggctcgacaagctgcgcagcgaccccgcgcgc
gatgccgccaagctggccgagctgcggccgcaggagcagcgctactggcggctggtggcc
gagcgcaagggcgtggtggacgagcgcatgctggagttccgctggctgctcgaggagctg
cgcgtgagcttcttcgcgcaggagctgcgcacgccgcagccggtcagcatcaagcggctg
gacaaggcctgggcccagctgcaggcctga

DBGET integrated database retrieval system