KEGG   Variovorax paradoxus S110: Vapar_2724Help
Entry
Vapar_2724        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3309 2TM
Motif
Other DBs
NCBI-ProteinID: ACS19346
UniProt: C5CLT9
Position
1:complement(2872625..2872783)
Genome map
AA seq 52 aa AA seqDB search
MSLSFILLIILILLLIGALPSWGYSRSWGYWPSGGLGLVVLIVIILVLMGRI
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcgttcattctgctgatcatcctgatattgcttctgatcggtgcgctgccg
agctggggctacagccggagctggggctactggcccagcggcgggctgggcctggtcgtg
ctgatcgtcatcatcctggtgctcatgggccgcatatga

DBGET integrated database retrieval system