KEGG   Variovorax paradoxus S110: Vapar_2727Help
Entry
Vapar_2727        CDS       T00916                                 

Definition
(GenBank) cobalamin (vitamin B12) biosynthesis CbiX protein
  KO
K03795  sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00860  Porphyrin and chlorophyll metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vapar_2727
Enzymes [BR:vap01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.3  sirohydrochlorin cobaltochelatase
     Vapar_2727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: ACS19349
UniProt: C5CLU2
Position
1:complement(2875138..2875512)
Genome map
AA seq 124 aa AA seqDB search
MATGNARGIVLLAHGSRDERWREPIEAVAARVTALDPQARVACAYMELAAPDLRTAAAAL
IASGARRLRVVPLFLGMGKHAREDLPLQVDALRQTWPQVDFQLAGIVGEEPELVDLLARI
ASKS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccacggggaatgcaaggggcatcgtgctgctggcccatggttcgcgcgacgaacgc
tggcgcgagcccatcgaggcggtggccgcacgcgtgacggcgctcgacccgcaggcccgc
gtggcctgcgcctacatggagcttgcggcgcccgacctgcgcaccgcggccgcggccctg
attgccagcggcgccaggagacttcgggtggttccgctcttcctcggcatgggcaagcat
gcccgcgaagacctgccgctgcaggtggatgcgctgcgccagacctggccgcaggtcgac
ttccagctggccggcatcgttggcgaagagcccgagctggtcgatctgctggccagaatt
gcaagcaaatcttga

DBGET integrated database retrieval system