KEGG   Variovorax paradoxus S110: Vapar_2729Help
Entry
Vapar_2729        CDS       T00916                                 

Definition
(GenBank) permease YjgP/YjgQ family protein
  KO
K07091  lipopolysaccharide export system permease protein
Organism
vap  Variovorax paradoxus S110
Pathway
vap02010  ABC transporters
Module
vap_M00320  Lipopolysaccharide export system
Brite
KEGG Orthology (KO) [BR:vap00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Vapar_2729
Transporters [BR:vap02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    Vapar_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjgP_YjgQ
Motif
Other DBs
NCBI-ProteinID: ACS19351
UniProt: C5CLU4
Position
1:complement(2876625..2877764)
Genome map
AA seq 379 aa AA seqDB search
MLFHSSLRKELSRSFGATLVVLVTIVMTMMLIRTLGLASKGSVNPSEVFLVMAYTVLGYM
PTILSLSLFIAIVGTLSRMYRDSEMVIWFSSGRGLADFVEPLFRFAWPVLVLIAVMALLG
WPWANSQTIGMRAQYEGRSDIERVTPGEFRESSGRMRVFFIDKDTPDGATATNVFIWAVE
RGLQITTSARSGRIENVGNNRFLMLSNGQRLERPLLPTAGLKISEFETYGTRAGGTSDFS
ADNTPARAKPTLQLLREPGDASHGELAWRIGMLLAAINFVLLALTVSSVNPRVGRSGNLL
FALFAFVVYYNMLNLGQSWISSGRFSMGSFMLLLHGGVLLIGVAWLLLRNNNWGRRRRTE
HVMAGGLPPSPPSKIDPTS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttattccattcttccctacgcaaggagctgtcgcgcagcttcggagcgaccctcgtg
gtcctggtcaccatcgtgatgaccatgatgctcatccgcacgctcgggctcgcctccaag
ggcagcgtgaacccgtccgaagtgttcctcgtgatggcgtacacggtgctcggctacatg
ccgaccatcctgagcctgagcctgttcatcgccattgtcggcaccttgtcgcgcatgtac
cgcgacagcgagatggtgatctggttttccagcggacggggcctggccgatttcgtcgag
ccgctgttccgcttcgcctggccggtgctggtgctgatcgcggtgatggcgctgctgggc
tggccgtgggccaactcgcagaccatcggcatgcgggcgcaatatgaagggcgcagcgac
atcgagcgggtcacgccgggcgaattccgcgaatcgtccgggcgcatgcgggtcttcttc
atcgacaaggacacgccggatggcgccacggccaccaacgtgttcatctgggcggtcgag
cgcggcctgcagatcacgacctcggcgcgcagcggacgcatcgagaacgtcggcaacaac
cgcttcctgatgctgagcaacgggcagcggctggagcggccgctgctgcccaccgcgggg
ctcaagatcagcgaattcgagacctatggcacccgggccggcggcacctccgacttctcc
gcggacaacacgccggcgcgcgccaagcccacgctccaactgctgcgcgagcccggcgac
gccagccacggcgagctggcctggcgcatcggcatgctgctggcggccatcaatttcgtg
ctgctggcgctgacggtgtcgagcgtcaacccgcgcgtggggcgaagcggcaacctgctg
ttcgcgctgttcgccttcgtcgtctactacaacatgctcaacctgggccagagctggatc
agctccgggcgcttcagcatgggctcgttcatgctgctgctgcacggcggcgtcctgctg
atcggcgtggcatggctgctcctgcgcaacaacaactggggccgcaggcgcaggaccgag
cacgtcatggccggcggcctgccgccttcgccgccctcgaaaatcgacccgacctcgtga

DBGET integrated database retrieval system