KEGG   Variovorax paradoxus S110: Vapar_2733Help
Entry
Vapar_2733        CDS       T00916                                 

Definition
(GenBank) Extracellular ligand-binding receptor
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
vap  Variovorax paradoxus S110
Pathway
vap02010  ABC transporters
vap02024  Quorum sensing
Module
vap_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:vap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Vapar_2733
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Vapar_2733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vap02000]
    Vapar_2733
Transporters [BR:vap02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Vapar_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ACS19355
UniProt: C5CLU8
Position
1:2880304..2881509
Genome map
AA seq 401 aa AA seqDB search
MQLKWTAVALAALTLVACGKKEEAAAPAAPAPTAAAPAPAAPPADALIVKIGHVGPTSGA
IAHLGKDNELGAKMAIEDLNAKGLKIGDKVAKFELLAEDDAGDPKQGTAVAQKLVDSKVN
GIVGHLNSGTTIPASKLYSDAGIPQVSPSATNPKYTRQGFKTTFRVVADDTQLGGTLGKY
AVETLKGKNIAVIDDRTAYGQGVAEEFEKAAKAAGGTIVGHEFTTDKSTDFNAILTKLKS
AKPDVLFFGGMDAVGGPMLKQVKQLGLNVKFMGGDGLCTGELPKLAGDAIGEEMVVCAEA
GGVDGDFKQPLEDFKARFKTKNGVDVQIYAPYVYDAVNVLAEAMVKAGSADPEKYLPEVG
KVQYKGVTGPIAFDEKGDIKNGALTLFTYKGGVRTQIAVVR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgaaatggactgcggtcgcactggctgctctcacgcttgtggcttgcggcaag
aaagaagaagctgctgcgcccgccgctccggcgcccacggcagcggcccccgcacctgca
gcgcctccggcagatgcattgatcgtcaagatcggccacgtcggccccaccagcggtgcc
attgcccacctgggcaaggacaacgagctcggcgccaagatggccatcgaagacctcaat
gccaagggcctgaagatcggcgacaaggttgccaagttcgaactgctggcagaagacgac
gccggcgatccgaagcaaggcaccgcagtggcccagaagctggtcgacagcaaggtcaac
ggcatcgtcggccacctgaactcgggcacgaccattcctgcttccaagctctacagcgac
gccggcattccgcaggtctcgccgtcggcaaccaaccccaagtacacgcgccagggcttc
aagaccacgttccgcgtggtggccgacgacacccagctcggcggcacgctcggcaagtac
gccgtcgaaacgctcaagggcaagaacattgccgtgatcgacgaccgcacggcctacggc
cagggcgttgccgaagagttcgagaaggcggccaaggctgccggcgggaccatcgtgggc
cacgaattcaccaccgacaagtcgaccgacttcaacgccatcctgaccaagctcaagtcc
gccaagcctgacgtgctgttcttcggcggcatggacgccgtcggcggcccgatgctcaag
caggtcaagcagctcggcctgaacgtcaagttcatgggcggcgacggcctgtgcaccggc
gaactgcccaagctggctggcgacgccatcggcgaagagatggtggtctgcgccgaggcc
ggcggtgtcgacggcgacttcaagcagccgctggaagacttcaaggccaggttcaagacc
aagaacggcgtggacgtgcagatctacgcaccgtacgtctacgacgcggtcaacgtgctg
gccgaagccatggtcaaggccggttccgccgaccctgaaaagtacctgcccgaagtcggc
aaggtgcaatacaagggcgtgaccggcccgatcgccttcgacgaaaagggcgacatcaag
aacggcgcgctgacgctcttcacctacaagggtggcgtgcgtacgcagatcgccgtggtt
cgctga

DBGET integrated database retrieval system