KEGG   Variovorax paradoxus S110: Vapar_2736Help
Entry
Vapar_2736        CDS       T00916                                 

Definition
(GenBank) band 7 protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 Band_7_C Pox_A11
Motif
Other DBs
NCBI-ProteinID: ACS19358
UniProt: C5CLV1
Position
1:complement(2882737..2883666)
Genome map
AA seq 309 aa AA seqDB search
MEFSVPIIILVIAIIFISQSVKFVPQQNAWVRERLGKYHGTMTPGPNFLIPFIDRVAYKH
SLKEIPLDVPSQICITRDNTQLQVDGILYFQVTDPMRASYGSSNYIVAVTQLAQTSLRSV
IGKLELDKTFEERDVINAQVVAAIDEAALNWGVKVLRYEIKDLTPPKEILLAMQAQITAE
RGKRALIAASEGRRQEQINIATGEREAFIARSEGEKQAQINNAQGEAAAITAVATATADA
IERVAAAIRQPGGEQAVQLKVAERAVDAYGKVAADSKTTLIVPSNMTETAALIASAMRMV
QAGKPQNPA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcggtccccatcatcatcctggtcattgcgatcatcttcatcagccagtcg
gtcaagttcgtgccgcagcagaacgcctgggtgcgcgagcgcctgggcaagtaccacggc
accatgacgcccggccccaacttcctgatcccgttcatcgaccgggtcgcctacaagcac
agcctgaaggaaatcccgctcgacgtgcccagccagatctgcatcacgcgcgacaacacc
cagctgcaggtcgacggcatcctgtacttccaggtgaccgacccgatgcgcgcgagctac
ggctcgtcgaactacatcgtggccgtgacgcagctggcgcaaacgtcgctgcgcagcgtg
atcggcaagctcgaactcgacaagaccttcgaggagcgcgacgtcatcaacgcgcaggtg
gtcgcggccatcgacgaggcggcgctcaactggggcgtgaaggtgctgcgctacgagatc
aaggacctgaccccgcccaaggaaatcctgctggccatgcaggcgcagatcaccgccgag
cgcggcaagcgcgccctcatcgccgcctccgaaggccgccgccaggagcagatcaacatc
gccaccggcgagcgcgaggccttcatcgcccgctccgaaggcgagaagcaggcccagatc
aacaatgcccagggcgaggccgccgccatcacggccgtggccaccgccacggccgacgcc
atcgaacgcgtggctgccgccatccgccagcccggcggcgaacaggccgtgcagctcaag
gtggccgagcgcgcggtcgacgcctacggcaaggtcgcggccgattccaagaccacgctg
atcgtgcccagcaacatgaccgaaaccgccgccctcatcgcctccgcgatgcgcatggtc
caggccggcaagccgcagaatccggcctga

DBGET integrated database retrieval system