KEGG   Variovorax paradoxus S110: Vapar_2741Help
Entry
Vapar_2741        CDS       T00916                                 

Definition
(GenBank) extracellular solute-binding protein family 5
  KO
K13893  microcin C transport system substrate-binding protein
Organism
vap  Variovorax paradoxus S110
Pathway
vap02010  ABC transporters
Module
vap_M00349  Microcin C transport system
Brite
KEGG Orthology (KO) [BR:vap00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Vapar_2741
Transporters [BR:vap02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    Vapar_2741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ACS19363
UniProt: C5CLV6
Position
1:2888271..2890067
Genome map
AA seq 598 aa AA seqDB search
MRVWLLLFLALSAAPSWAAHAYAQFGDIKYPPGFTHFSYVNPNAPKGGEIRMVPPTRPTN
FDKLNPFTLKGTAPSGIGSLIFESLMTGNSEEPTTVYGLLAEDVEVAPDRLSATFRLNPK
ARFNDGSPVLAADVVHSFNTLTGPLAAPQYRTIYAEVKKATATSERVVRFDFASPNRELP
LVIGGMAVFSRQWGGGKPFDQIVTEMPIGSGPYKPASDRLGRDITYVRRADYWGADLPVR
KGLYNFDRITFRVYLDETARFEGLKAGEFDFMREFTSRNWARQYKGRQFDSGEIVKRAFE
NHNPGDFQGYVFNIRKDKFKDVRVRQAIGLAMDFEWLNRQLFYGLYTRVQGYFPNSEFHA
EGLPKPDELALMEPLRSKLKPEVFGPAPQPPSTAPPNSLRENLRKARALLEEAGWTYRDG
ALRNAKNEAFTIEFLNDQPGLIRVVTPLQTALRKLGIEMTFRTVDFSLSQQRMQNFDFEM
TSLRLPGNSAPGGELLELFGSKAADTTGSSNIWGIADPAVDAVVGKVLAATTRPELATAM
RVLDRVLSNGYYSIPQYYGNAFLVGYRPAPFVLPPTIPPYYDAGDWALTTWWASPINK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtttggctgcttctttttctggcgctctcggcggctccttcatgggccgcccat
gcctacgcgcagttcggcgacatcaagtacccgcccggcttcacccacttcagctacgtc
aatccgaacgcgcccaagggcggcgagatccggatggtgccgcccacgcggcccaccaac
ttcgacaagctcaacccgttcacgctcaagggcacggcgccatcgggcatcggctcgctg
attttcgagagcctgatgacgggcaattccgaagagccgaccacggtctatggcctgctt
gccgaagacgtcgaggtggcgcccgaccgcctgtcggccaccttccgcctgaaccccaag
gcgcgcttcaacgacggctcgccggtgctggcggccgacgtggtgcattcgttcaacacc
ctgaccggcccgctggccgcgccgcagtaccgcaccatctacgcagaagtgaagaaggcg
acggccaccagcgagcgcgtcgtgcgcttcgacttcgcgagtccgaaccgcgagctgccg
ctggtgatcggcggcatggcggtcttcagccgccaatggggcgggggcaagccgttcgac
cagatcgtcaccgagatgccgatcggctccggcccctacaagccggccagcgaccgcctg
ggccgcgacatcacctacgtgcgccgcgccgactactggggcgccgacctgccggtgcgc
aaggggctgtacaacttcgatcgcatcaccttccgggtctacctggacgaaaccgcgcgc
ttcgagggcctgaaggccggcgagttcgacttcatgcgcgaattcacctcgcgcaactgg
gcgcgccagtacaagggcaggcagttcgacagcggcgagatcgtcaagcgcgccttcgag
aaccacaaccccggcgatttccagggctatgtgttcaacatccgcaaggacaagttcaag
gacgtgcgcgtgcgccaggccattggtttggccatggatttcgagtggctcaaccgccag
ctgttctacggcctctacacgcgggtgcagggctactttccgaacagcgagttccacgcc
gagggcctgcccaagcccgacgaactcgcgctgatggagccgctgcgcagcaagctcaag
cccgaggtgttcggcccggccccgcagccgccgagcacggcgccgcccaacagcctgcgc
gagaacctgcgcaaggcgagggcgctgctggaggaggccggctggacctaccgcgacggc
gcgctgcgcaacgcgaagaacgaggccttcacgatcgagttcctcaatgaccagcccggg
ctgatccgcgtcgtgacaccgctgcagacggcgctgcgcaagctcggcatcgagatgacc
ttccgcacggtcgatttctcgctctcgcagcagcgcatgcagaacttcgacttcgagatg
acctcgctgcgcctgcccggcaacagcgcgccgggcggcgagctgctcgagctgttcggc
tccaaggcggccgacacgacgggctcgtccaacatctggggcattgccgatccggcggtg
gacgcggtggtcggcaaggtgctggcggccaccacgcggcccgagctggccacggccatg
cgcgtgctcgaccgggtgctctccaatggctactactcgatcccgcagtactacggcaac
gctttcctggtcggctaccggccggcgccgttcgtgctgccgccgaccattccgccgtac
tacgatgccggcgactgggcgctcaccacgtggtgggcttcgcccatcaacaaatga

DBGET integrated database retrieval system