KEGG   Variovorax paradoxus S110: Vapar_2742Help
Entry
Vapar_2742        CDS       T00916                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K13894  microcin C transport system permease protein
Organism
vap  Variovorax paradoxus S110
Pathway
vap02010  ABC transporters
Module
vap_M00349  Microcin C transport system
Brite
KEGG Orthology (KO) [BR:vap00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Vapar_2742
Transporters [BR:vap02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    Vapar_2742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACS19364
UniProt: C5CLV7
Position
1:2890095..2891129
Genome map
AA seq 344 aa AA seqDB search
MTSYILKRLLLMIPTLLGVLVITFGVIQFVPGGPVEQMVAQLQGRDSGGERAAASGAGYR
GRQGLDPQRVEDIRKLYGFDKPAHERLWTMLKSFARFDLGTSFYQRKDVWQLIKEKMPVS
ISLGLWTFFISYLIAVPLGVAKAVRAGTRFDFVTTLIVLVGYAIPGFVLGVALLVIFGGQ
LQWFPLRGLTSPNWESMNWGARVVDYLWHIALPVTSMVLGSFAVTAMLTKNSFLEEIRKQ
YVLTARAKGLSQRQVLWKHVFRNALIPIITGFPSAFIGAFFTGSLLIETLFTLDGLGLLS
YESVIRRDYPVVLGTLYLFTLIGLVTKLISDLCYVWVDPRVKFD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctacatcctcaagcgcctgctgctgatgatccccacgctgctgggcgtgctc
gtcatcaccttcggcgtgatccagttcgtgccgggcggcccggtcgagcagatggtggcg
cagctgcaggggcgcgattcaggcggcgagcgggccgcggccagcggcgccggctaccgc
ggccgccagggcctcgacccgcagcgcgtcgaggacatccgcaagctctacggcttcgac
aagcccgcccacgagcgcctgtggaccatgctgaagtcgttcgcacgcttcgacctgggc
accagcttctaccagcgcaaggacgtctggcagctcatcaaggagaagatgccggtgtcg
atcagcctcggcctctggaccttcttcatcagctacctgatcgcggtgccgctgggcgtg
gccaaggccgtgagggccggcacgcgcttcgacttcgtcaccacgctgatcgtgctggtc
ggctatgccattccgggcttcgtgctgggggtggcgctgctcgtgatcttcggcgggcag
ctgcagtggtttccgctgcgcggcctcacgtcgcccaactgggagagcatgaactggggc
gcacgcgtcgtcgactacctgtggcacatcgcgctgccggtgacctcgatggtgctcggc
agctttgccgtcaccgccatgctcacgaagaattctttcctcgaggaaatccgcaagcag
tacgtgctgaccgcgcgcgccaaggggctgtcgcagcggcaggtgctctggaagcatgtg
ttccgcaatgcgctgatcccgatcatcaccggctttccgtcggccttcatcggtgcgttc
ttcaccggctcgctgctgatcgagacgctgttcacactcgacggcctgggcctgctgagc
tacgagagcgtgatccgccgcgactatcccgtggtgctgggcacgctctacctgttcacg
ctgatcggcctggtcaccaagctgatttccgacctctgctacgtctgggtcgatccgagg
gtcaagtttgactag

DBGET integrated database retrieval system