KEGG   Variovorax paradoxus S110: Vapar_2743Help
Entry
Vapar_2743        CDS       T00916                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K13895  microcin C transport system permease protein
Organism
vap  Variovorax paradoxus S110
Pathway
vap02010  ABC transporters
Module
vap_M00349  Microcin C transport system
Brite
KEGG Orthology (KO) [BR:vap00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Vapar_2743
Transporters [BR:vap02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    Vapar_2743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-ProteinID: ACS19365
UniProt: C5CLV8
Position
1:2891122..2892168
Genome map
AA seq 348 aa AA seqDB search
MTRAAVVVSASPGRRAWRRFRRNPLGFWSLVVFSMLVVLSLFAELLSTEKPLVVRYAGQT
YFPVLRDYSEKTFGGDFETPADYLDPFIQKRITEGANWALYAPNRYGPRTLNYFASQPNP
AAPSGENFFGTDDRGRDLLAQLIYGFRVSVLFGLALTVIGTVLGVAAGAVQGYFAGKIDL
AFQRFIEIWASMPELYLLIIFSAIFAPSVALLLILLSLFGWMGLADYVRAEFLRNRQMDY
VRAARALGVGNLQIMWRHILPNSMVPVVTFLPFRMSAAILALTSLDFLGLGVPPGTPSLG
ELLSQGKANIDAWWISLSTFGVLVVTLMLLTFMGDALRDALDPRKADK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgactagagccgccgttgtcgtttccgcgagcccgggccgccgcgcctggcgtcgcttc
cgccgcaatccgctggggttctggagcctggtcgtcttctcgatgctggtggtgctgagc
ctgttcgccgagctgctgtccaccgaaaagccgctggtcgtgcgctacgccgggcagacc
tacttcccggtgctgcgcgactactccgagaaaaccttcggcggagacttcgaaacgccc
gccgactacctcgatcccttcatccagaagcgcatcaccgagggcgccaactgggcgctc
tatgcacccaaccgctacggcccgcgcacgctgaactactttgcctcccagcccaatccc
gcggcgccttcgggcgagaacttcttcggcaccgacgaccgcggccgcgacctgcttgcg
cagctgatctacggctttcgcgtgagcgtgctgttcggcctggcgctgaccgtcatcggc
accgtgctgggcgtggcggcgggggcggtgcagggctacttcgcgggcaagatcgacctc
gcgttccagcgcttcatcgagatctgggcatcgatgcccgagctctacctgctgatcatc
ttcagcgcgatcttcgcgcccagcgtggcgctgctgctgatcctgctgagcctgttcggc
tggatgggcctggccgactacgtgcgcgccgaattcctgcgcaaccgccagatggactac
gtgcgcgccgctcgggcgctgggcgtgggcaacctgcagatcatgtggcgccacatcctg
cccaacagcatggtgccggtcgtcacattcctgccgtttcgcatgagcgcggccatcctg
gcgctcacttcgctcgatttcctgggcctgggcgtgccgccgggcacgccgtcgctcggc
gaactgctgagccagggcaaggccaacatcgacgcctggtggatctcgctgtcgaccttc
ggcgtgctggtcgtgacgctgatgctgctcaccttcatgggcgacgcgctgcgcgatgcc
ctcgatccgcggaaggccgacaagtga

DBGET integrated database retrieval system