KEGG   Variovorax paradoxus S110: Vapar_2745Help
Entry
Vapar_2745        CDS       T00916                                 

Definition
(GenBank) protein of unknown function DUF1228
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_4 MFS_1
Motif
Other DBs
NCBI-ProteinID: ACS19367
UniProt: C5CLW0
Position
1:2893819..2895018
Genome map
AA seq 399 aa AA seqDB search
MSDIGRDRRGAWRAALACMVTLAVAMGLGRFAFTPMLPIMLHEGKLQLEAGGVLASLNYL
GYFLGAVSCAAIGIQAKRMVRGGLVATAALLVGMGVLHSFTSWGILRTAAGVMSAWVFVF
ASGWGLRRLAETHSPALAGVIYTGPGIGIAMTGLLGGALGRWGSEAGWIGLGLLAVVLVV
LIWRVFDDGELPSGQGSAGAPSAQAGAAASPSARSDAVWLVALYGLAGFGYIITATFLPV
IARQALPGSPWPDFFWPLFGLAIIPGALIGARAPVHWDNRLLLAAAYALQALGVVLSVAW
PTITGFALGSLLLGMPFTAITLFAMRDARRLRGNAAAGLIGYATASYGVGQIIGPLFAAP
LAQRTGSFELPLLVAAAALALGSVLFAVVWSKSRRKVAL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcggacgagacaggcgcggcgcctggcgcgcggcactggcgtgcatggtg
accttggccgttgccatgggcctggggcgctttgccttcacgcccatgctgccgatcatg
ctgcacgagggaaagctccaactcgaggccggcggcgtgctggcttcgctcaattacctt
ggttactttctgggcgcggtcagttgcgcggccatcggcatccaggccaagcgcatggtg
cgcggcggcctggtggccacggccgcgctgctggtgggcatgggggtgctccacagcttc
acgagctggggcatcctgcgcaccgcggccggcgtgatgagcgcctgggtcttcgtcttt
gcgtccggctggggcctgcggcggctcgccgagacccattccccggcgctggccggcgtg
atctacaccggccccggcatcggcatcgcgatgaccggcctgctcggcggcgccctgggg
cgctggggttccgaggcgggatggatcggcctgggcctgctggcggtggtgctggtggtg
ctgatctggcgcgtgttcgatgatggcgaactgccctcggggcaaggctccgcgggcgcg
ccttccgcccaggccggtgcggccgcgtcgccttccgcacgcagcgacgccgtctggctg
gtcgcgctctatgggctggcgggcttcggctacatcatcaccgccaccttcctgccggtg
atcgcgcgccaggcactgccgggctcgccgtggcccgacttcttctggccgctgttcggg
ctggcgatcatccccggcgcgctgatcggcgcccgcgcgcccgtgcactgggacaaccgg
ttgctgctggccgcggcctatgcgctgcaggcgctgggcgtggtgctgtcggtggcctgg
cccaccatcaccggctttgcgctcggcagcctgctgctgggcatgcctttcacggcaatc
accctttttgcgatgcgggatgcgcgccggctgcgcggcaatgccgcggccggactgatc
ggctatgcgaccgcttcctatggcgtcgggcagatcatcggcccgctgtttgcggcgccg
ctggcccagcggaccgggtctttcgagctcccgctgctggtggcggccgccgcattggcg
ctcggatcggtgctgtttgccgtcgtctggtcaaaatcccggcgcaaagtggcgctttga

DBGET integrated database retrieval system