KEGG   Variovorax paradoxus S110: Vapar_2746Help
Entry
Vapar_2746        CDS       T00916                                 

Definition
(GenBank) protein of unknown function DUF150
  KO
K09748  ribosome maturation factor RimP
Organism
vap  Variovorax paradoxus S110
Brite
Ribosome biogenesis [BR:vap03009]
 Prokaryotic Type
  Other maturation factors
   Vapar_2746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF150 DUF150_C
Motif
Other DBs
NCBI-ProteinID: ACS19368
UniProt: C5CLW1
Position
1:2895188..2895826
Genome map
AA seq 212 aa AA seqDB search
MALQQTVEQTVAGLGYDLVEIERSAGGLLRVTIDLPWTAPTSEAVAAGIPEPFVTVEDCE
KVTRQLQFALEVDGVDYKRLEVSSPGIDRPLRNEQDFERFVGEVIDITLKAPMGAAAAGQ
VSATRKKFRGTLERVAGADGAPGWQIVWSDAPEPKPGQKVSKKRAPAKLHALGFVLDELR
DARLAPIVDFKGRKAKTQPGFSDIDDGTNVPD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtggcattgcagcagacagtggaacaaaccgttgccggtctcggctacgacctggtcgag
atcgaacgctcggccgggggattgctgcgcgtgacaattgatttgccctggactgccccc
acatcggaagctgtggctgcaggcattcccgaacccttcgtgacggtcgaggattgcgag
aaggtcacgcgccagttgcagtttgcgctcgaggtcgacggtgtcgattacaagcggctc
gaggtttcctcgccgggtattgaccgtccgcttcgcaatgagcaggatttcgagcgtttc
gtgggcgaggtgatcgacatcacgctcaaggcgcccatgggtgccgcggcggcggggcag
gtgtctgccacccgcaagaagtttcgcggcacgctggagcgcgtggcgggggccgacggg
gccccgggctggcaaatcgtctggagcgatgcgccggagcccaaaccgggtcaaaaagtc
agcaagaagcgcgcgcctgcaaagttgcatgcgctgggtttcgtgctggatgagctgcgc
gatgcgcggctcgcgccaattgtggatttcaagggccgcaaggccaaaacccaaccgggt
ttttcggatattgacgacggaaccaacgttccggactga

DBGET integrated database retrieval system