KEGG   Variovorax paradoxus S110: Vapar_2749Help
Entry
Vapar_2749        CDS       T00916                                 

Definition
(GenBank) ribosome-binding factor A
  KO
K02834  ribosome-binding factor A
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vap03009]
    Vapar_2749
Ribosome biogenesis [BR:vap03009]
 Prokaryotic Type
  Other maturation factors
   Vapar_2749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RBFA
Motif
Other DBs
NCBI-ProteinID: ACS19371
UniProt: C5CLW4
Position
1:2900332..2900703
Genome map
AA seq 123 aa AA seqDB search
MPKRKAAAPNRAFKVADQIQRDLTELIARELKDPRVGMVTIQAVEVTPDYAHAKIYFSML
TGDVTETTEALNQAAGFLRNGLFKRLHIHTVPTLHFLFDRTTERAADMNALIAQAVASRS
KDD
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagagaaaagccgccgcccccaaccgcgcgttcaaggttgccgaccagatccag
cgcgatctgacggagctgatcgcgcgcgagttgaaggacccgcgcgtgggcatggtcacg
atccaggcggtcgaggtcacgcccgactatgcgcacgcgaagatctacttcagcatgctc
acgggcgacgtgaccgagaccaccgaagcgctgaaccaggccgcggggttcctgcgcaac
ggcctgttcaagcgcctgcacatccacaccgtgccgacgctgcacttcctgttcgaccgc
accaccgagcgtgcggccgacatgaatgcgctcatcgcgcaggccgtcgcttcgcgttcg
aaagacgactag

DBGET integrated database retrieval system