KEGG   Variovorax paradoxus S110: Vapar_2750Help
Entry
Vapar_2750        CDS       T00916                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Vapar_2750
Transfer RNA biogenesis [BR:vap03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Vapar_2750
 Prokaryotic Type
    Vapar_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2
Motif
Other DBs
NCBI-ProteinID: ACS19372
UniProt: C5CLW5
Position
1:2900706..2901662
Genome map
AA seq 318 aa AA seqDB search
MNAPRTRVQRRPVHGVLLLDKPLGLSSNQALQKAKWLLRAEKAGHTGTLDPLATGVLPLC
FGAATKFSQLHLDADKTYEATARLGIKTSTGDAEGDVIAERPVHVTAEDLARVEVQFTGP
IRQVPPMHSALKKDGKALYEYAREGIEIERAPRDVIIHKLALTQLDGSRIRIVACVSKGT
YIRTLGEDIGEALGCGAHLTSLRRTATGGFGEAECVTIEALEAMAEDERLARLLPAEALV
EGHSRVTLAAEDAARFLSGLRRRGGWADAEAVAVFGTDPQAFLGTAHVSAGELIPGRLLN
PIEIQQILLNAQQTEATP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgccacgcacaagggtgcagcggcgccctgtgcatggggtgttgttgctcgac
aagccgctgggactctccagcaaccaggccttgcagaaggccaagtggttgctgcgcgcc
gaaaaagcgggccacaccggcacgctcgatccgctggccaccggcgtgctgccgctgtgc
tttggcgcggccaccaagttcagccagctgcacctcgatgccgacaagacctacgaggcc
acggcacgccttggcatcaagacctccaccggcgacgccgagggcgacgtgattgccgag
cgcccggtgcatgtcaccgcggaagacctggcccgcgtcgaagtgcagttcaccggcccg
atccggcaggttccgccgatgcacagcgcgctcaagaaggacggcaaggcgctgtacgag
tacgcgcgcgaaggcatcgagatcgagcgcgcgccgcgcgacgtcatcattcacaagctc
gcgctgacgcagctggacggctcccgcatccgcatcgttgcgtgcgtgagcaagggcacc
tacattcgcacgctgggcgaggacatcggcgaggcactgggctgcggcgcgcacctcacg
tcgctgcgccgcacggccacgggcggtttcggcgaggcggagtgcgtcacgatcgaggcg
ctcgaagccatggccgaagacgagcgcctggcacgcctgttgcctgccgaagcactggtc
gagggccacagccgcgtcacgctcgccgccgaagatgcggcacgttttctttcaggcctg
cgccgccgtggcggctgggccgatgccgaagcggtggccgtgttcggcaccgacccgcag
gcgttcctgggcaccgcccatgtgagcgccggcgaactgatcccggggcgcttgctgaac
cccatcgaaatccagcaaattcttttgaacgcacaacagaccgaagcgacaccatga

DBGET integrated database retrieval system