KEGG   Variovorax paradoxus S110: Vapar_2751Help
Entry
Vapar_2751        CDS       T00916                                 

Definition
(GenBank) GTP-binding protein TypA
  KO
K06207  GTP-binding protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_C MMR_HSR1 GTP_EFTU_D2 EFG_II AIG1 FeoB_N Septin SRPRB
Motif
Other DBs
NCBI-ProteinID: ACS19373
UniProt: C5CLW6
Position
1:2901659..2903494
Genome map
AA seq 611 aa AA seqDB search
MSTKQIRNIAIIAHVDHGKTTMVDQLLRQSGTFAEHEKVVDTVMDNNAIEKERGITILAK
NCAVTWEGTHINIVDTPGHADFGGEVERALSMVDGVVLLIDAQEGPMPQTRFVTKKALAL
GLKPILVVNKVDKPGANPDKVVNAAFDLFDKLGATDEQLDFPVVYASGINGWSSLEEGAP
GEQWGPDMSALFNTILKHVPAQKGDPDAPLQLQISALDFSTFVGRIGVGRISQGTLKPMM
DVLVMEGPDGKTVKGRVNQVLTFQGLDRVQATEAGPGEIVLINGIADIGIGVTVTDPANP
SPLPMLKVDEPTLTMNFCVNTSPLAGREGKFVTSRQIWDRLQKELQHNVALRVNETDEEG
IFEVMGRGELHLTILLENMRREGYEMAVSKPRVVFRTVNGEKHEPIELVTADIEEQHQGG
VMQALGERKGELVNMEPDGRGRVRLEYRIPARGLIGFTNEFLNLTRGSGLISNIFDSYEP
HKGEIGSRKNGVLISMDDGEIFTYALGKLDDRGRMFVKANDPVYEGMIVGIHSRDNDLVV
NATRTKQLTNFRVSGKEDAIKITPPIELTLEYGVEFIEDDELVEITPKSVRLRKRFLKEN
ERKRASREMAS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccaagcaaatccgcaatatcgccatcattgcccacgtcgaccatggcaagacc
acgatggtcgaccagctgctgcggcagtcgggcacctttgccgagcacgagaaagtggtc
gacacggtgatggacaacaacgccatcgaaaaggaacgtggcatcacgatcctggccaag
aactgcgccgtgacctgggaaggcacgcacatcaacatcgtcgacacccccggccacgcg
gacttcggcggcgaagtggagcgcgcgctgtcgatggtcgatggcgtggtgctgctgatc
gacgcacaggaaggcccgatgccgcagacgcgcttcgtgaccaagaaggcgctggccctg
ggcctgaagccgatcctggtcgtgaacaaggtcgacaagccgggcgccaaccccgacaag
gtggtgaacgccgccttcgacctgttcgacaagctcggcgccaccgacgaacagctcgac
ttccctgtggtgtacgcctcgggcatcaacggctggtcgtcgctcgaagagggtgcgccc
ggcgagcagtggggccccgacatgtcggcgctgttcaacaccatcctgaagcatgtgccg
gcgcagaagggcgatccggacgcaccgctgcagctgcagatctcggcgctcgacttctcg
accttcgtcggccgcatcggcgtgggccgcatcagccagggcacgctcaagcccatgatg
gacgtgctggtgatggaaggtccggacggcaagaccgtcaagggccgcgtcaaccaggtg
ctgaccttccagggcctggaccgcgtgcaggccaccgaagccggcccgggcgagatcgtg
ctgatcaacggcattgccgacatcggcatcggcgtgaccgtgaccgatccggccaacccg
tcgccgctgcccatgctcaaggtcgacgaaccgaccctgaccatgaacttctgcgtcaac
accagcccgctggccggccgcgaaggcaagttcgtcaccagccgccagatctgggaccgc
ctgcagaaggaactgcagcacaacgtggcgctgcgcgtgaacgaaaccgacgaggaaggc
atcttcgaggtgatgggccgcggcgaactgcacctgaccatcctgttggaaaacatgcgc
cgcgaaggctatgaaatggccgtgtccaagccgcgcgtggtgttccgcaccgtcaacggc
gagaagcacgagccgatcgagctggtgaccgccgacatcgaagagcagcaccagggcggc
gtgatgcaggccctgggcgagcgcaagggcgagctggtcaacatggaaccggacggccgc
ggccgcgtgcgcctggagtaccgcattccggcgcgtggcctgatcggcttcaccaacgaa
ttcctgaacctgacgcgcggctcgggcctcatcagcaacatcttcgacagctacgagccg
cacaagggcgagatcggcagccgcaagaacggcgtgctgatttccatggacgacggtgaa
atcttcacctacgccctgggcaagctggacgaccgcggccgcatgttcgtgaaggcgaac
gatccggtgtacgaaggcatgatcgtgggcatccacagccgcgacaacgacctggtggtg
aacgccacgcgcaccaagcagctgaccaacttccgtgtctcgggcaaggaagacgcgatc
aagatcacgccgccgatcgaactcacgctggaatacggcgtggaattcatcgaggacgac
gagctggtcgagatcacgcccaagagcgtgcgcctgcgcaagcgtttcctcaaggaaaac
gagcgcaagcgcgccagccgcgaaatggcgagctga

DBGET integrated database retrieval system