KEGG   Variovorax paradoxus S110: Vapar_2758Help
Entry
Vapar_2758        CDS       T00916                                 

Definition
(GenBank) cyclase/dehydrase
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc Polyketide_cyc2 DUF1857
Motif
Other DBs
NCBI-ProteinID: ACS19380
UniProt: C5CLX3
Position
1:2907374..2907820
Genome map
AA seq 148 aa AA seqDB search
MKTVNKSVLIWYSAEEMYALVTDVEKYPQFLPWCDKSRVIEEDEAGMTAEVGLAFAGLHQ
SFTTRNTHVPGREVHLKLVDGPFSNLDGLWKFVPVGEPGERACRVELHMSYGFSNFALQA
LVGPVFDTVASSLVEAFVKRAEQVYGTS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtcaacaagtccgtcctcatctggtacagcgccgaagagatgtacgcgctc
gtcaccgacgtggagaaatatccgcagttcctgccctggtgcgacaagtccagggtcatc
gaggaagacgaggccggcatgaccgccgaagtgggcctggcctttgccggccttcaccag
agtttcaccacccgcaacacccacgtgccggggcgcgaggtgcacctcaagctggtcgat
ggacccttctccaacctcgacggcctctggaaattcgtgcccgtgggcgagcccggcgag
cgcgcctgccgcgtcgagctgcacatgagctacggcttcagcaactttgctttgcaggcg
ctggtggggccggtattcgacaccgtggcctccagcctggtcgaagccttcgtcaagcgt
gccgagcaggtctacggcacgtcctga

DBGET integrated database retrieval system