KEGG   Variovorax paradoxus S110: Vapar_2759Help
Entry
Vapar_2759        CDS       T00916                                 

Definition
(GenBank) protein of unknown function UPF0125
  KO
K09801  uncharacterized protein
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Vapar_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ub-RnfH TGS ThiS
Motif
Other DBs
NCBI-ProteinID: ACS19381
UniProt: C5CLX4
Position
1:2907820..2908155
Genome map
AA seq 111 aa AA seqDB search
MIEVTLCCSPAPREVFEQVLRLAPQATVADAVKASELAQRFPQLDWREAMTPGIWGREVG
WEQPLEDGDRVELCRPLAVDPKVARRERFQRQGARGTGLFANRRKGGKAGY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagtcacgctctgctgctcgcccgcgccgcgcgaggtgttcgagcaggtgctg
cggctggcgccccaagccaccgtggccgatgccgtgaaggccagcgaacttgcgcagcgc
ttcccgcagctcgattggcgcgaggccatgacgccgggaatctggggcagggaagtcggc
tgggagcagccgctcgaggacggcgaccgcgtcgagctgtgccgtcccttggcggtcgat
ccgaaggtggcgcgccgtgagcgcttccagcgccagggcgcgcgcggcaccggtcttttc
gcgaaccgccgcaagggcggcaaggccggctactga

DBGET integrated database retrieval system