KEGG   Variovorax paradoxus S110: Vapar_2765Help
Entry
Vapar_2765        CDS       T00916                                 

Definition
(GenBank) transcriptional regulator, HxlR family
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_5 PadR
Motif
Other DBs
NCBI-ProteinID: ACS19387
UniProt: C5CLY0
Position
1:complement(2912851..2913228)
Genome map
AA seq 125 aa AA seqDB search
MTTPSSHPTCGTGGFSCGLDATLRIISGKWKPLILFFLRDGPRRYGELKRLIEGVSDKVL
IQHLKDLEADRVLARTDYKEVPPRVDYALTPLGRSLAEAIVPLCTWGTEHMAEVASIFAK
RETLS
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccttcttctcatccaacctgcggtaccggcggcttctcctgcgggctcgac
gccacgctgcgcatcatctcgggcaagtggaaaccgttgatcctgtttttcctgcgcgac
ggcccgaggcgctacggcgaactcaagcgcttgatcgaaggcgtcagcgacaaggtcctg
atccagcatctgaaggatctggaggccgatcgcgtgctggcgcggaccgactacaaggag
gtaccgccgcgcgtggactacgcgctgaccccgctcggccgcagcctggccgaagcgatc
gttccgctgtgcacctggggaaccgagcacatggcggaagtggcaagcatcttcgccaag
cgcgaaactttgtcctag

DBGET integrated database retrieval system